KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP2868cHelp
Entry
MAP2868c          CDS       T00156                                 

Gene name
dfrA
Definition
DfrA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    MAP2868c (dfrA)
   00670 One carbon pool by folate
    MAP2868c (dfrA)
Enzymes [BR:mpa01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     MAP2868c (dfrA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3195689..3196234)
Genome map
AA seq 181 aa AA seqDB search
MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRP
LPGRRNVVVSRRPDFVAEGARVAGSLEAALAHAGSDPAPWVIGGAQIYLLALPHATRCEV
TEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRP
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtgccgaggtgggcctggtgtgggcccagtcgacgtctggcgtcatcggccgc
ggcggtgacatcccgtggagcgtgcccgaagacctcacccggttcaaagaggtgaccatg
gggcacacggtgatcatgggccggcggacctgggagtcgttgccggccaaggtgcggccg
ctgcccggccggcgcaacgtggtggtgtcgcgccggcccgacttcgtcgccgagggggcg
cgggtggccgggtcgctggaggcggccctcgcgcacgccgggagcgacccggcgccgtgg
gtgatcggcggcgcgcagatctatctgctggcgctgccgcatgccacccgctgcgaggtc
accgagatcgagatcgacctgcgccgcgacgacgacgacgcgctggcgccggcgctggac
gacagctgggtgggcgagacgggcgagtggctggccagccgctccgggctgcggtaccgg
ttccacagctaccgtcgggacccgcgctcttccgttcgcggctgttcgccctcacgcccg
agctga

DBGET integrated database retrieval system