KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP2868cHelp
Entry
MAP2868c          CDS       T00156                                 

Gene name
dfrA
Definition
DfrA
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mpa00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mpa00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Structure
PDB: 

Jmol
Position
complement(3195689..3196234)
Genome map
AA seq 181 aa AA seqDB search
MTRAEVGLVWAQSTSGVIGRGGDIPWSVPEDLTRFKEVTMGHTVIMGRRTWESLPAKVRP
LPGRRNVVVSRRPDFVAEGARVAGSLEAALAHAGSDPAPWVIGGAQIYLLALPHATRCEV
TEIEIDLRRDDDDALAPALDDSWVGETGEWLASRSGLRYRFHSYRRDPRSSVRGCSPSRP
S
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtgccgaggtgggcctggtgtgggcccagtcgacgtctggcgtcatcggccgc
ggcggtgacatcccgtggagcgtgcccgaagacctcacccggttcaaagaggtgaccatg
gggcacacggtgatcatgggccggcggacctgggagtcgttgccggccaaggtgcggccg
ctgcccggccggcgcaacgtggtggtgtcgcgccggcccgacttcgtcgccgagggggcg
cgggtggccgggtcgctggaggcggccctcgcgcacgccgggagcgacccggcgccgtgg
gtgatcggcggcgcgcagatctatctgctggcgctgccgcatgccacccgctgcgaggtc
accgagatcgagatcgacctgcgccgcgacgacgacgacgcgctggcgccggcgctggac
gacagctgggtgggcgagacgggcgagtggctggccagccgctccgggctgcggtaccgg
ttccacagctaccgtcgggacccgcgctcttccgttcgcggctgttcgccctcacgcccg
agctga

DBGET integrated database retrieval system