KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP2904Help
Entry
MAP2904           CDS       T00156                                 

Gene name
echA16_2
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MAP2904 (echA16_2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAP2904 (echA16_2)
   00650 Butanoate metabolism
    MAP2904 (echA16_2)
  Lipid metabolism
   00071 Fatty acid degradation
    MAP2904 (echA16_2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAP2904 (echA16_2)
   00310 Lysine degradation
    MAP2904 (echA16_2)
   00360 Phenylalanine metabolism
    MAP2904 (echA16_2)
   00380 Tryptophan metabolism
    MAP2904 (echA16_2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAP2904 (echA16_2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAP2904 (echA16_2)
   00281 Geraniol degradation
    MAP2904 (echA16_2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAP2904 (echA16_2)
   00627 Aminobenzoate degradation
    MAP2904 (echA16_2)
   00930 Caprolactam degradation
    MAP2904 (echA16_2)
Enzymes [BR:mpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAP2904 (echA16_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3234183..3234932
Genome map
AA seq 249 aa AA seqDB search
MTDEILLSNTEERVRTLTLNRPQARNALSAALRDRFFGALADAETDDDVDVVIITGADPV
FCAGLDLKELGGSSALPDISPRWPALTKPVIGAINGAAVTGGLELALYCDILIASENARF
ADTHARVGLLPTWGLSVRLPQKVGIGLARRMSLTGDYLSAADALRAGLVTEVVPHDQLLG
AAQAVAASIVGNNQNAVRALLASYHRIDDAQTSAGLWQEAMAARQFRTSGDDIAANREAV
LARGRSQVR
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacgagatcctgctgagcaacaccgaggagcgggtgcgcaccctcaccctcaac
cggccccaggcccgcaacgcgctgtccgcggccttgcgggaccgcttcttcggcgccctg
gccgacgccgagacggacgacgacgtggacgtcgtcatcatcaccggcgccgatccggtg
ttctgcgcggggctggatctcaaggagctgggcggctcgtcggcgctgccggacatctcg
ccgcgctggccggcgctgaccaagccggtgatcggcgccatcaacggcgccgcggtcacc
ggtgggctggagctggcgctgtattgcgacatcctgatcgcctcggagaacgcccgcttc
gccgacacgcacgcccgggtcggcctgctgcccacctgggggctgagcgtgcggctgccg
cagaaggtgggcatcggcctggcccgccggatgagcctgaccggcgactacctgtcggcg
gccgacgcgctgcgggccgggctggtcaccgaggtggtgccgcacgaccagctgttgggc
gccgcccaggccgtggcggcctcgatcgtcgggaacaaccagaacgcggtgcgcgcgctg
ctggcctcctatcaccgcatcgacgacgcgcagaccagcgcggggctgtggcaggaggcc
atggcggcccggcagttccggaccagcggcgacgacatcgccgccaaccgggaggcggtg
ctggcgcgcggccgctcccaggtccgctga

DBGET integrated database retrieval system