KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP2919cHelp
Entry
MAP2919c          CDS       T00156                                 

Definition
hypothetical protein
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mpa00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3251350..3253191)
Genome map
AA seq 613 aa AA seqDB search
MKPYPFSAIVGHDRLRLALLLCAVRPEIGGALIRGEKGTAKSTAVRGLAALLSAATGSDA
NLVEMPLGATEDRVIGSLDLQRVLRDGEHAFSPGLLARAHGGVLYVDEVNLLHDHLVDVL
LDAAAMGRVHIERDGISHSHDARFVLIGTMNPEEGELRPQLLDRFGLTVDVHASRDVEVR
AQVIRQRMAYEADPDGFAERYADADAELARRIAAARALVDDVVLPDTELQRIAALCAAFD
VDGMRADLVVARAAVAHAAWRGAPTVEEQDIRVAAELALPHRRRRDPFDDPGIDREQLDE
ALAQAGSEPDPDPDPPGGGQAGETEQQPPQRDSAQDAKPRPPTTKPSAPPSKTFRTRALR
VPGVGEGAPGRRSRARNASGSVIAATDGADTGCGGHGLHLFATLLSAAERAGAGPLRPGP
DDVRRAVREGREGNLVIFVVDASGSMAARDRMAAVSGATLSLLRDAYQRRDKVAVITFRQ
QQARLLLPPTSSAHIAGRRLARFDTGGKTPLAEGLLAARELIVREKARDRARRALVVVLT
DGRATAGPDPLGRSRIAAARLVAEGAAAVVVDCETSYVRLGLAEHLARQLGAPAVRLEQL
HADSLTRAVRDAA
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
gtgaagccctacccgttcagcgccatcgtcgggcacgaccggctgcggctggccctgctg
ctgtgcgccgtgcgcccggagatcggcggcgcgctcatccgcggcgagaagggcaccgcc
aagtcgacggccgtgcgcggcctggcggccctgctgtccgccgccaccggcagcgacgcg
aacctggtcgaaatgccgctcggcgcaaccgaagaccgggtgatcggctcgctggacctg
cagcgggtgctgcgcgacggcgagcacgcgttctccccggggctgctggcccgcgcgcac
ggcggtgtgctctacgtcgacgaggtcaacctgctgcacgatcatctcgtcgacgtgttg
ctcgacgccgcggcgatgggacgggtgcacatcgaacgcgacggcatctcgcattcgcat
gacgcccggttcgtgttgatcggcaccatgaatcccgaagagggcgaactgcgtccgcag
ctgctggaccggttcgggctcaccgtcgacgtgcatgcctcgcgtgacgtggaggtgcgg
gcgcaggtgatccggcagcggatggcctatgaggccgacccggacggtttcgccgaacgc
tacgccgacgccgacgccgagctggcccggcgcatcgccgcggcgcgcgccctggtcgac
gacgtggtgttgcccgacaccgagttacagcgcatcgcggcgctgtgcgcggcgttcgac
gtggacggcatgcgggccgatctggtggtggcccgcgccgcggtcgcgcacgcggcctgg
cgcggcgcgcccaccgtcgaggagcaggacatccgggtggccgccgagctggccctgccg
caccgccgccgccgcgatcccttcgacgacccgggcatcgaccgcgagcaactggacgag
gccctggcccaggccggctccgagcccgacccggatcccgacccgcccggcggaggccag
gccggcgagacagaacagcaaccgccgcaacgggattcggcgcaggacgccaagccgcgg
ccgccgacgacgaaaccgagtgcgccgccgtcgaagacgtttcgcacccgcgcgctgcgg
gtccccggtgtcggcgaaggggcacccggccggcggtcgcgggcccgcaacgccagcggc
agcgtcatcgcagccaccgacggcgccgacaccggctgcggcggccacgggctgcacctg
ttcgccaccctgctctcggccgccgaacgggccggtgccgggccgctgcggccggggccc
gacgatgtgcgacgggccgtgcgcgagggtcgcgaaggcaatctggtgatcttcgtcgtc
gacgcctccggatcgatggcggcgcgggaccggatggcggcggtcagcggtgccacgctg
tcgctgctgcgcgacgcctatcagcgccgcgacaaggtcgccgtgatcacgttccggcaa
cagcaggcgcggctgctgttgccgcccacctcctcggcgcacatcgccgggcggcggctg
gcccgcttcgacaccggcggcaagacgccgctggccgaagggctgctggccgcgcgcgag
ctgatcgtccgggagaaggcccgcgaccgggcgcgccgcgccctcgtggtggtgctcacc
gacggccgggccaccgccggcccggatccgttgggccgcagccggatcgccgcggcccgg
ctggtcgccgagggcgcggccgcggtggtggtggactgcgaaacgtcgtatgtgcggctg
ggcctggccgaacacctggcacgccagctgggcgccccggcggtgcggctggagcagttg
catgcggattcgctgacgcgtgcggtgcgcgacgccgcctga

DBGET integrated database retrieval system