KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3063Help
Entry
MAP3063           CDS       T00156                                 

Definition
hypothetical protein
Orthology
K16149  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAP3063
Enzymes [BR:mpa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     MAP3063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3407735..3409339
Genome map
AA seq 534 aa AA seqDB search
MNSSHDRVPGLFTLVLHTHLPWLAHHGRWPVGEEWLYQSWAAAYLPLLRVLDTLAGEDRR
GLLTLGVTPVVNAQLDDPYCLDGMHHWLANWRLRAMEAASVRSAPRSKSAGYQACTPEAL
RALGIRESAEAERALDDFATRWRHGGSPLLRRLLDAGTVELLGGPLAHPFQPLLAPRLRE
FALREGLADAALRLGARKGRGPGGIWAPECAYAPGLEHDYAAAGVTHFMVDGPSLHGDTA
LGRPVGDTDVVAFGRDLQVSYRVWSPKSGYPGHPAYRDFHTYDHLTGLKPARVTGRNVPS
ESKAPYDPQRADHAVDLHVADFVDVVRNRLTSESERIGRPAHVVAAFDTELFGHWWYEGP
TWLARVLRALPEAGVRVGTLHDAIAGGFVGDPVDLPPSSWGSGKDWQVWAGDQVADLVQL
NSEVVDTALSTVDKALSQAGSQPAALDGPVPRDRVADQILRETLLTVSSDWPFMVSKDSA
ADYARYRAHLHAHATREIAGALASGRRDTAQRLADGWNRADGLFGALDARRLPR
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
gtgaattcctcgcacgaccgggttcccggcctgttcaccctggttttgcacacccacctg
ccgtggctggcccaccacggccgctggccggtcggcgaggaatggctgtatcaatcctgg
gcggcggcctacctgccgctgctgagggtgctggacacgctggccggcgaagaccgccgg
ggactgctcacgctcggcgtcacaccggtggtcaacgcgcagctcgacgacccgtattgc
cttgacggcatgcatcattggctggccaactggcggctgcgcgcgatggaagctgccagt
gtgcgctcggcgccccggtccaagtcggccggataccaggcgtgcacaccggaagcgttg
cgcgccttgggaattcgcgaatcggccgaggcggaacgagccctggacgatttcgccacg
cggtggcggcacggcggcagcccgctgctgcgccgactgctggacgccggcacggtcgag
ttgctgggcggcccgctggcccacccgttccagccgctgctggcaccgcggctgcgtgag
ttcgcgctgcgcgaggggctggccgacgcggcgttgcggctcggggcgcgaaaaggccgg
ggccccggcgggatctgggcgcccgaatgcgcctacgcgcccggcctcgagcacgactac
gccgcggccggcgtcacccatttcatggtcgacggcccgtcgctgcacggcgacaccgcg
ctgggccggcccgtcggcgacaccgacgtggtggcgttcgggcgcgacctgcaggtcagc
taccgggtgtggtcaccgaagtccggctatcccggccacccggcgtatcgcgacttccac
acctacgaccacctcaccggtctcaagccggcccgggtgacgggccgcaacgtgccctcg
gagagcaaggcgccctacgatccgcagcgcgccgaccacgcggtcgacctgcacgtcgcc
gacttcgtcgacgtggtgcgcaaccgcctgaccagcgagtcggagcggatcgggcggccg
gcgcacgtggtggccgcgttcgacaccgagctgttcgggcactggtggtacgagggcccg
acgtggttggcgcgggtgctgcgcgccctgcccgaggccggggtccgggtgggcaccctg
cacgacgcgatcgccggcggcttcgtcggcgacccggtggacctgccgcccagctcctgg
gggtcgggcaaggactggcaggtgtgggccggggaccaggtcgccgacctggtccagctc
aactccgaggtggtcgacaccgcgctgagcaccgtcgacaaggccctctcacaagccggg
tcgcagcccgccgcgctggacgggccggtcccccgcgaccgcgtggcggaccagatcctg
cgcgagaccctgctcaccgtctccagcgactggccgttcatggtgagcaaggactcggcc
gccgactacgcccgctaccgcgcccacctgcacgcacacgccacccgggagatcgcgggc
gcgctggcgtccggccggcgcgacaccgcgcagcggctggccgacgggtggaaccgcgcc
gacgggctgttcggggcgctggatgcgcgcaggctgccgcgatga

DBGET integrated database retrieval system