KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3064Help
Entry
MAP3064           CDS       T00156                                 

Definition
hypothetical protein
Orthology
K16150  
glycogen(starch) synthase [EC:2.4.1.11]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    MAP3064
Enzymes [BR:mpa01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.11  glycogen(starch) synthase
     MAP3064
Glycosyltransferases [BR:mpa01003]
 Polysaccharide
  Storage polysaccharide
   MAP3064
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3409356..3410612
Genome map
AA seq 418 aa AA seqDB search
MKILMVSWEYPPVVIGGLGRHVHHLSTALAAAGHDVVVLSRRPTGTDSRTHPSTDQISEG
VRVIAAAQDPHEFTFGTDMMAWTLAMGHAMIRAGLPPKLHDKKPGGNRPWRPDVVHAHDW
LVAHPAIALAQFYDVPMVSTIHATEAGRHSGWVSGPISRQVHAIESWLVRESDSLITCSA
SMADEITELFGPGLAEITVIRNGIETARWPFAPRRPRTGPAELLYLGRLEYEKGVHDVIA
ALPRIRRTHPGTTLTIAGEGTQQGWLVEQARKHRVLKAIRFVGHLEHSELLAMLHRADAA
VLPSHYEPFGIVALEAAAAGTPLVTSNIGGLGEAVIDGQTGVSCPPRDVPALAAAIRTVL
DDPEAAQRRACAARERLTSDFDWHTVADKTAQVYLSAKRAERQPQARLPIVEHALPDR
NT seq 1257 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcctgatggtgtcgtgggagtacccgccggtggtcatcggcgggctgggccgg
cacgtgcatcacctgtccaccgcgctggccgcggccggccacgacgtcgtcgtgctgtcc
cgccgccccaccgggaccgactcgcgcacccacccgtcgaccgaccagatcagcgagggc
gtccgggtgatcgcggccgcgcaggacccgcacgaattcaccttcggcaccgacatgatg
gcctggacgttggcgatgggccacgccatgatccgcgccgggctgccccccaaactgcac
gacaagaagccgggcggcaaccgcccctggcgtcccgacgtcgtgcacgcgcacgactgg
ctggtggcccatcccgcgatcgcgctcgcccaattctacgacgtgccaatggtttccacc
atccacgccaccgaagcgggtcggcattcgggttgggtcagcgggccgatcagccgtcag
gtgcacgcgatcgagtcgtggctggtgcgcgaatccgattcgctgatcacctgttcggcg
tcgatggccgacgagatcaccgaactgttcggccccgggctggccgagatcacggtgatc
cgcaacggtatcgagaccgcccgctggccgttcgcgccccgccggccgcgcaccgggccg
gccgagctgctgtatctgggacggctcgagtacgagaagggcgtgcacgatgtcatcgcc
gcgctgccgcgcatccggcgcacccacccgggcaccacgctgaccatcgccggcgagggc
acgcagcagggctggctggtcgaacaggcgcgaaaacaccgggtgctcaaggcaatccga
ttcgtcggccacctcgaacactccgagctgctggcgatgctgcaccgcgccgacgccgcg
gtgctgcccagccactacgagccgttcggcatcgtggcgctggaggcggccgcggccggc
actcccctggtcacgtcgaacatcggcggcctgggcgaggcggtgatcgacggccagacc
ggcgtctcgtgcccgccccgcgacgtgcccgcgctggccgcggcgatccgcaccgtgctc
gacgatccggaggccgcgcagcggcgcgcctgcgccgcccgggaacggctcacctcggac
ttcgactggcacacggtggccgacaagaccgcgcaggtgtacctgtccgccaagcgggcg
gagcggcagccgcaggcccggctgcccatcgtcgaacacgccttgcccgaccggtag

DBGET integrated database retrieval system