KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3235cHelp
Entry
MAP3235c          CDS       T00156                                 

Definition
hypothetical protein
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MAP3235c
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    MAP3235c
Enzymes [BR:mpa01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     MAP3235c
Two-component system [BR:mpa02022]
 CheA family
  CheA-CheYBV
   MAP3235c
Bacterial motility proteins [BR:mpa02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    MAP3235c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3589819..3590838)
Genome map
AA seq 339 aa AA seqDB search
MVIAAADGDLQSDLRGAVAIGASAGGVEALSNLAAGLSPDVPFAYLMVLHVPAGAPSILA
RIIDRSGPLPASAAQDGAPLQPGHIYVGVPDRHLLVDGAHVLLSQGPTENGHRPAINALF
RSVALTFGPRAIGVLLSGVLDDGVLGMAAIRSRGGVTVCQSPDDALFPAMPANALDAGVV
DRQAAAADIGVVLKELAHREIEDPDMQRDPGMELENRIAMMSRFATDFDTEKLGPPSGYT
CPDCNGSLVSLSEGNYRCRVGHAWTAEALLSARDNELEGALWVAVRSLQEKARLARDMAG
KAGAGLLSRRYTQIAEESERALHVLSHRLAGAAAEGETR
NT seq 1020 nt NT seq  +upstreamnt  +downstreamnt
gtggtgattgcggcggcagacggcgaccttcagagcgaccttcgtggcgcggtagcgatc
ggtgcgtcggccggcggcgtcgaggcgctgtcgaacctcgccgccgggttgtcgccggac
gtgccgttcgcgtatctgatggtgctgcacgtgcccgcgggagcgcccagcatcctggcc
cgcatcatcgaccgcagcggtccgctgcccgcctccgccgcgcaggacggcgcgccgctg
caacccgggcacatctacgtcggcgtcccggaccggcatctgctggtcgacggcgcgcac
gtgctgctgtcgcaggggccgaccgagaacggccaccggcccgccatcaacgcgttgttc
cggtcggtggcgctgacgttcgggccgcgcgcgatcggcgtgctgctctccggtgtgctc
gacgacggcgtgctggggatggcggccatccgctcccgcggcggggtcaccgtctgccaa
tcacccgacgacgcactgttcccggcgatgccggccaacgccctggacgccggtgtggtg
gaccggcaggccgccgcggccgacatcggcgtggtgctcaaggagctggcgcaccgagag
atagaggatcccgacatgcaacgcgaccccgggatggagctggagaatcgcatcgccatg
atgtcgcggttcgccaccgacttcgacaccgaaaagctgggcccgccgtccggctacacc
tgtcccgactgcaacggctcgctggtctcgctcagcgagggcaactaccgctgccgggtc
ggtcatgcctggacggccgaggccctgctgagcgcgcgggacaacgagctcgagggcgcc
ctgtgggtggcggtgcgcagcctgcaggagaaggcccggctggcccgtgacatggccggc
aaggccggggcgggcctgctctcgcggcgctacacccagatcgccgaggaaagcgaacgc
gcgctgcacgtgctcagccaccggctggccggcgccgccgccgagggtgaaacccggtga

DBGET integrated database retrieval system