KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3375Help
Entry
MAP3375           CDS       T00156                                 

Definition
F420-0--gamma-glutamyl ligase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Energy metabolism
   00680 Methane metabolism
    MAP3375
Enzymes [BR:mpa01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.31  coenzyme F420-0:L-glutamate ligase
     MAP3375
    6.3.2.34  coenzyme F420-1:gamma-L-glutamate ligase
     MAP3375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3748069..3749418
Genome map
AA seq 449 aa AA seqDB search
MSPAGEHGTAAPIEILPVAGLPEFRPGDDLGAAVAKAAPWLRDGDVVVVTSKAVSKCEGR
LVPAPADPEERDRLRRKLVDEEAVRVLARKGRTLITENRHGLVQAAAGVDGSNVGRDELA
LLPLDPDASAAALRARLRELLGVEVAVLVTDTMGRAWRNGQTDAAVGAAGLAVLHGYSGA
VDQHGNELLVTEVAIADEIAAAADLVKGKLTAMPVAVVRGLSVTDDGSTARQLLRPGTED
LFWLGTAEAIELGRRQAQLLRRSVRRFSAEPVPAELVREAVAEALTAPAPHHTRPVRFVW
LQTPAVRTRLLDAMKDKWRADLAGDGRPAESIERRVARGQILYDAPEVVIPMLVPDGAHS
YPDAARTDAEHTMFTVAVGAAVQALLVGLAVRGLGSCWIGSTIFAADLVRTELGLPADWE
PLGAIAIGYAAEPAGPRGPADPGDLLIRK
NT seq 1350 nt NT seq  +upstreamnt  +downstreamnt
gtgagtcccgccggcgagcacggcaccgccgccccgatcgagatcctgccggtggccggg
ctgcccgaattccgccccggcgacgatctgggggcggccgtcgccaaggccgcgccgtgg
ctgcgcgacggcgacgtcgtcgtcgtcaccagcaaggccgtctccaagtgcgagggccgg
ctggtgccggcgccggccgatcccgaggaacgcgatcggctgcggcgcaagctggtcgac
gaggaagccgtccgggtgctggcccgcaagggccgcaccctgattaccgagaaccggcac
gggctggtgcaggccgccgccggggtagacggatccaacgtcggccgcgacgagctggcg
ctgctgccgctggaccccgacgccagcgccgcggcgctgcgcgcgcggctgcgcgagcta
ctgggcgtcgaggtcgccgtgctggtcaccgacaccatgggccgcgcctggcgcaacggc
cagaccgacgccgcggtgggggcggcgggactggctgtgctgcacggctattcgggtgcg
gtggatcagcacggcaacgagctgctggtcaccgaggtggcgatcgccgacgagatcgcc
gcggccgccgatctggtgaagggcaaactgaccgcgatgccggtggcggtggtgcgcggg
ctgtcggtgaccgacgacgggtcgaccgcccggcagttgttgcggccgggcaccgaggac
ctgttctggctgggcaccgccgaggccatcgagttgggccgccgccaggcgcagctgctg
cgccgttcggtgcgccggttcagcgccgagccggtgcccgcggagctggtgcgcgaggcc
gtcgccgaggccctgaccgcgccggccccgcaccacacccgcccggtgcggttcgtctgg
ctgcagaccccggcggtgcggacccggctgctggacgcgatgaaggacaagtggcgcgcc
gacctggccggcgacggccggcccgccgagtcgatcgaacgccgggtggcgcgcggccag
atcctctacgacgcgcccgaagtcgtcatcccgatgctggtccccgacggcgcgcacagc
tatcccgacgccgcccgcaccgacgccgagcacaccatgttcaccgtggcggtcggcgcg
gccgtgcaggccctgctggtcgggttggcggtgcgcggcctgggcagctgctggatcggc
tccacgatcttcgccgccgacctggtgcgcaccgagctcgggttgcccgccgactgggag
ccgttgggggccatcgccatcggctatgccgccgaacccgccgggccgcggggtccggcg
gaccctggggatctgctgatccgcaagtga

DBGET integrated database retrieval system