KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3442Help
Entry
MAP3442           CDS       T00156                                 

Gene name
sdhD
Definition
SdhD
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAP3442 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    MAP3442 (sdhD)
   00650 Butanoate metabolism
    MAP3442 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    MAP3442 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3821276..3821746
Genome map
AA seq 156 aa AA seqDB search
MSTPDLQLGPGQIAPVKQRFYDRPASLDNPRSPRRRAGIPNFEKFAWLFMRFSGVALFVL
AIGHLFIMLMWDDGVYRIDFNYVAQRWASPFWQLWDLALLWLAQLHGGNGLRTIIDDYSR
KDSTRFWLNSLLLLSMGFTLVLGTYVLLTFDPNISG
NT seq 471 nt NT seq  +upstreamnt  +downstreamnt
atgagcacccccgacctgcagctcggcccgggccagatcgccccggtcaaacagcgcttc
tacgaccgcccggccagcctggacaatccccgctccccgcggcgccgcgccggcatcccc
aacttcgagaagttcgcctggctgttcatgcggttctccggcgtcgcgctgttcgtgctg
gcgatcggccacctgttcatcatgctgatgtgggacgacggcgtgtaccgcatcgacttc
aattacgtggcgcagcgctgggcgtcgccgttctggcagctctgggacctggcgctgctg
tggctggcccagctgcacggcggcaacgggctgcgcaccatcatcgacgactacagccgc
aaggacagcacccggttctggctgaacagcctgctgctgctgtcgatgggcttcaccctg
gtgctgggcacctacgtgctgctgaccttcgacccgaacatctcgggatag

DBGET integrated database retrieval system