KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3513Help
Entry
MAP3513           CDS       T00156                                 

Definition
hypothetical protein
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAP3513
   00040 Pentose and glucuronate interconversions
    MAP3513
   00053 Ascorbate and aldarate metabolism
    MAP3513
   00620 Pyruvate metabolism
    MAP3513
  Lipid metabolism
   00071 Fatty acid degradation
    MAP3513
   00561 Glycerolipid metabolism
    MAP3513
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAP3513
   00310 Lysine degradation
    MAP3513
   00330 Arginine and proline metabolism
    MAP3513
   00340 Histidine metabolism
    MAP3513
   00380 Tryptophan metabolism
    MAP3513
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAP3513
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAP3513
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MAP3513
Enzymes [BR:mpa01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     MAP3513
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3912063..3913499
Genome map
AA seq 478 aa AA seqDB search
MREYLKFYIDGQWVDPVRPNTFDVENPATEQVCGKISLGSAADVDVAVGAARRAFGRWSQ
SSREDRLDLLQAILAEYQKRADDLAAAVTEEIGAPPSLAAGPQVFLGIGHLTTAIEVLKN
FPFTEQRGATLIAREPIGVCGLITPWNWPINQVAVKVYPALATGCTVVLKPSEVAPFSSY
IFAEILAAAGVPAGVFNLVNGDGPGVGAALASHPDIDLVSFTGSTRAGVEVARNAAPTVK
RVTQELGGKSPNIVLDDGGFADAVRAGVANMMPNSGQSCNAPSRMLVPASRMAEAISIAR
EVAEQVQVGDPDDATAIGPVASRAQFEKVQRLIQQGIDEGATVVAGGPGRPAGLDQGYYV
KPTVFADVTNDMTIAREEIFGPVLCILGYDDLDHAVRLANDTDYGLAGYVSGADLDTARE
VAGKIRAGWVTINHAFDLNAPFGGYKRSGNGREWSDFGFHEYLEVKSILGYAPAQGDQ
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatacctgaagttctacatcgacggacaatgggtcgacccggtgcggcccaac
acgttcgacgtggaaaacccggcgaccgaacaggtgtgcggcaagatctcgctggggtcg
gcggccgacgtcgacgtcgcggtcggcgccgcgcgccgagccttcggccgctggtcgcag
agcagccgcgaagaccggctggacctgttgcaggccatcctcgccgaataccagaagcgc
gccgacgatctcgccgcggcggtcaccgaggagatcggcgcgccgccctcgctggcggcc
ggcccgcaggtctttctcggcatcggccacctgaccacggccatcgaggtgttgaagaac
ttcccgttcaccgagcaacgcggggcgacgctgatcgccagggaacccatcggcgtctgc
ggcctgatcaccccgtggaactggccgatcaaccaggtcgcggtgaaggtctacccggcg
ctggccaccggctgcaccgtggtgctgaaaccgtccgaggtggcgccgttctcgtcgtac
atcttcgccgagatcctggccgccgcgggggtgccggccggggtgttcaacctggtcaac
ggcgacgggccgggcgtgggcgcggccctggcgagccatcccgacatcgacctggtgtcg
ttcaccgggtccacccgcgccggggtcgaggtggcccgcaacgccgccccgacggtcaag
cgcgtcacccaggaactcggcggaaaaagccccaacatcgtcctggacgacggcggcttc
gccgacgcggtccgggccggggtggccaacatgatgcccaattcggggcagagctgtaac
gccccgtcgcgcatgctggtgcccgcgtcccggatggccgaggccatctccatcgcccgc
gaggtcgccgaacaggtgcaggtgggcgaccccgacgacgcgacggcgatcgggccggtg
gcgtcgcgcgcgcagttcgagaaggtgcagcggctgatccagcagggcatcgacgagggc
gcaacggtggtggccggcggcccgggccggccggcggggctcgaccagggctactacgtc
aagccgaccgtcttcgccgacgtcaccaacgacatgacgatcgcccgcgaggagatcttc
ggtccggtgctgtgcattctcggctacgacgacctcgaccacgccgtccggctcgccaac
gacaccgattacggcctggccggctacgtttcgggcgccgacctggacacggcgcgcgag
gtggccggcaagatccgggccggatgggtgaccatcaaccacgccttcgacctgaacgcg
ccgttcggcggctacaaacgtagcggcaacggccgcgaatggagcgacttcggcttccac
gagtacctggaagtcaaaagcatcctcggctacgcgccggcccagggagaccagtag

DBGET integrated database retrieval system