KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3513Help
Entry
MAP3513           CDS       T00156                                 

Definition
hypothetical protein
Orthology
K00128  
aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Glycolysis / Gluconeogenesis
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Arginine and proline metabolism
Histidine metabolism
Tryptophan metabolism
beta-Alanine metabolism
Glycerolipid metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Propanoate metabolism
Limonene and pinene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mpa00010]
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mpa00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:mpa00053]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mpa00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mpa00640]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:mpa00071]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:mpa00561]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:mpa00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:mpa00310]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mpa00330]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:mpa00340]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:mpa00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:mpa00410]
Metabolism; Metabolism of terpenoids and polyketides; Limonene and pinene degradation [PATH:mpa00903]
Metabolism; Xenobiotics biodegradation and metabolism; Chloroalkane and chloroalkene degradation [PATH:mpa00625]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3912063..3913499
Genome map
AA seq 478 aa AA seqDB search
MREYLKFYIDGQWVDPVRPNTFDVENPATEQVCGKISLGSAADVDVAVGAARRAFGRWSQ
SSREDRLDLLQAILAEYQKRADDLAAAVTEEIGAPPSLAAGPQVFLGIGHLTTAIEVLKN
FPFTEQRGATLIAREPIGVCGLITPWNWPINQVAVKVYPALATGCTVVLKPSEVAPFSSY
IFAEILAAAGVPAGVFNLVNGDGPGVGAALASHPDIDLVSFTGSTRAGVEVARNAAPTVK
RVTQELGGKSPNIVLDDGGFADAVRAGVANMMPNSGQSCNAPSRMLVPASRMAEAISIAR
EVAEQVQVGDPDDATAIGPVASRAQFEKVQRLIQQGIDEGATVVAGGPGRPAGLDQGYYV
KPTVFADVTNDMTIAREEIFGPVLCILGYDDLDHAVRLANDTDYGLAGYVSGADLDTARE
VAGKIRAGWVTINHAFDLNAPFGGYKRSGNGREWSDFGFHEYLEVKSILGYAPAQGDQ
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgaatacctgaagttctacatcgacggacaatgggtcgacccggtgcggcccaac
acgttcgacgtggaaaacccggcgaccgaacaggtgtgcggcaagatctcgctggggtcg
gcggccgacgtcgacgtcgcggtcggcgccgcgcgccgagccttcggccgctggtcgcag
agcagccgcgaagaccggctggacctgttgcaggccatcctcgccgaataccagaagcgc
gccgacgatctcgccgcggcggtcaccgaggagatcggcgcgccgccctcgctggcggcc
ggcccgcaggtctttctcggcatcggccacctgaccacggccatcgaggtgttgaagaac
ttcccgttcaccgagcaacgcggggcgacgctgatcgccagggaacccatcggcgtctgc
ggcctgatcaccccgtggaactggccgatcaaccaggtcgcggtgaaggtctacccggcg
ctggccaccggctgcaccgtggtgctgaaaccgtccgaggtggcgccgttctcgtcgtac
atcttcgccgagatcctggccgccgcgggggtgccggccggggtgttcaacctggtcaac
ggcgacgggccgggcgtgggcgcggccctggcgagccatcccgacatcgacctggtgtcg
ttcaccgggtccacccgcgccggggtcgaggtggcccgcaacgccgccccgacggtcaag
cgcgtcacccaggaactcggcggaaaaagccccaacatcgtcctggacgacggcggcttc
gccgacgcggtccgggccggggtggccaacatgatgcccaattcggggcagagctgtaac
gccccgtcgcgcatgctggtgcccgcgtcccggatggccgaggccatctccatcgcccgc
gaggtcgccgaacaggtgcaggtgggcgaccccgacgacgcgacggcgatcgggccggtg
gcgtcgcgcgcgcagttcgagaaggtgcagcggctgatccagcagggcatcgacgagggc
gcaacggtggtggccggcggcccgggccggccggcggggctcgaccagggctactacgtc
aagccgaccgtcttcgccgacgtcaccaacgacatgacgatcgcccgcgaggagatcttc
ggtccggtgctgtgcattctcggctacgacgacctcgaccacgccgtccggctcgccaac
gacaccgattacggcctggccggctacgtttcgggcgccgacctggacacggcgcgcgag
gtggccggcaagatccgggccggatgggtgaccatcaaccacgccttcgacctgaacgcg
ccgttcggcggctacaaacgtagcggcaacggccgcgaatggagcgacttcggcttccac
gagtacctggaagtcaaaagcatcctcggctacgcgccggcccagggagaccagtag

DBGET integrated database retrieval system