KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3564Help
Entry
MAP3564           CDS       T00156                                 

Definition
hypothetical protein
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3962958..3963899
Genome map
AA seq 313 aa AA seqDB search
MSSLRTHDDTWDIKSSVGTTAVMVAAARAVETEQPDPLIRDPYAKLLVTNSGAGVLWEAM
LDPDIAARVEALDEESAAHLHHMRGYQAVRTHFFDTYFADAVAAGIRQIVILASGLDSRA
YRLDWPAGTTVYEIDQPQVLAYKSTTLAENGVTPSADRREVAVDLRQDWPAALRAAGFDP
TQRTAWLAEGLLMYLPAEAQDRLFTLIGELSPAGSRVAAETAPNHADERRQQMRERFKKV
ADEIGFEQTVDVGELMYRDDHRADVTEWLNAHGWRATAEHSTAAMRRLGRWIENVPLADD
KDAFSDFVVAERR
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgagctcactgcgcacccacgacgacacctgggacatcaagagcagtgtcggcaccacc
gcggtgatggtggccgccgcccgcgccgtcgagaccgagcagcccgacccgctgatccgc
gacccgtacgccaagctgctggtcaccaactccggcgccggcgtgctgtgggaggccatg
ctcgaccccgacatcgccgcccgggtggaggccctggacgaggaatcggcggcgcacctg
caccacatgcgcggctaccaggcggtgcggacccacttcttcgacacctacttcgccgac
gccgtcgccgccgggatccggcagatcgtgatcctggcctcgggactggactcccgggcg
taccggctggactggccggccggcaccaccgtctacgagatcgatcagccgcaggtgctg
gcctacaaatccaccaccctcgccgagaacggggtgacgccgtccgccgatcgccgcgag
gtcgccgtcgatctgcgccaggactggccggccgcgctgcgcgccgccggcttcgacccc
acccagcgcaccgcctggctggccgaagggctgctgatgtacctgcccgccgaggcgcag
gaccggctgttcaccctgatcggcgagctcagcccggccggcagccgggtggccgccgaa
accgcgcccaaccacgccgacgagcggcgccagcagatgcgggaacggttcaagaaggtg
gccgacgagatcggcttcgagcagaccgtcgacgtcggcgagctgatgtaccgcgacgac
caccgcgccgacgtcaccgagtggctcaacgcgcacggctggcgcgccacggccgagcac
tcgaccgccgcgatgcgccggctcggtcgctggatcgagaacgtcccgctggccgacgac
aaggacgccttctccgacttcgtcgtcgccgagcgccgctaa

DBGET integrated database retrieval system