KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3596cHelp
Entry
MAP3596c          CDS       T00156                                 

Gene name
adhE
Definition
AdhE
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    MAP3596c (adhE)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAP3596c (adhE)
  Lipid metabolism
   00071 Fatty acid degradation
    MAP3596c (adhE)
  Amino acid metabolism
   00350 Tyrosine metabolism
    MAP3596c (adhE)
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    MAP3596c (adhE)
   00626 Naphthalene degradation
    MAP3596c (adhE)
Enzymes [BR:mpa01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     MAP3596c (adhE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3993354..3994445)
Genome map
AA seq 363 aa AA seqDB search
MLQRIGAPRPYARSRPITITDVELAPPGRDEVLVRIEAAGICHSDLSVVDGNRVRPVPML
LGHEAAGIVERVGPGVADLAVGARVVLVFLPRCGRCAACATEGLTPCEPGSAANGAGTLL
GGDIRLSRAGRPVYHHLGVSGFATHAVVNRASAVEVPPDVPAEVAALLGCAVLTGGGAVF
NVGRPAPGQTVAVVGLGGVGMAALLTALTYDGVPVVAVDQLPEKLAAARRLGAHQAYTPQ
QAVEARVKAAVVIEAVGHPAALQTAIDLTAPGGRTITVGLPPPDARITLSPLGFVAEGRS
LIGSYLGSAVPSRDIPRFVELWRAGRLPVESLVSSTIRLEDINEAMDHLADGTAVRQLIR
FDA
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
gtgctgcagcgcatcggggcgccccggccctatgcgcgctcgcgaccgatcaccatcacc
gacgtggagttggcgcccccggggcgcgacgaggtcttggtccgcatcgaggcggccggc
atctgccattccgacctgtcggtggtcgacggcaaccgggtgcgcccggtgccgatgctg
ctcggtcacgaggcggccgggatcgtcgagcgggtcggtcccggggtcgccgacctggcc
gtgggcgcccgggtggtgctggtgttcctgccgcgctgcggccggtgcgcggcgtgcgcg
accgagggcctgacgccgtgtgaaccgggcagcgcggccaacggggccggcacgctgctg
ggcggcgatattcggctcagccgggccggccggccggtgtatcaccacctcggggtctcg
gggttcgccacgcacgcggtggtcaatcgggccagcgcggtcgaggtgccgcccgacgtg
ccggccgaggttgccgcgctgctcggctgcgcggtgctgaccggcggcggcgcggtgttc
aacgtgggccgccccgcgccgggccagacggtcgccgtcgtcgggctgggcggcgtcggg
atggcggcgcttctgaccgcgctcacctacgacggcgttccggtggtcgccgtcgaccag
ctgccggagaagctggccgcggcccggcggttgggcgcgcaccaggcgtacacgccgcag
caggccgtcgaggcgcgggtgaaggcggcggtggtgatcgaagccgtcggccatcccgcc
gcgctgcagactgcgatcgacctgacggcccccggcgggcgcaccatcaccgtcggcctg
ccgccgccggacgcgcggatcacgttgtcgccgttgggttttgtggccgagggccggtcg
ctgatcggcagctacctcggttcggcggtgccgagccgggacatcccccggttcgtcgag
ctgtggcgcgcgggccggctgccggtggaatcgctggtgtcgtccacgatccggctggaa
gacatcaacgaggcgatggatcatctggccgacggcaccgcggtgcgccagctgatccgg
ttcgacgcctaa

DBGET integrated database retrieval system