KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3658Help
Entry
MAP3658           CDS       T00156                                 

Gene name
echA1_2
Definition
(RefSeq) enoyl-CoA hydratase (EC:4.2.1.17)
  KO
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MAP3658 (echA1_2)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAP3658 (echA1_2)
   00650 Butanoate metabolism
    MAP3658 (echA1_2)
  Lipid metabolism
   00071 Fatty acid degradation
    MAP3658 (echA1_2)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAP3658 (echA1_2)
   00310 Lysine degradation
    MAP3658 (echA1_2)
   00360 Phenylalanine metabolism
    MAP3658 (echA1_2)
   00380 Tryptophan metabolism
    MAP3658 (echA1_2)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAP3658 (echA1_2)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAP3658 (echA1_2)
   00281 Geraniol degradation
    MAP3658 (echA1_2)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAP3658 (echA1_2)
   00627 Aminobenzoate degradation
    MAP3658 (echA1_2)
   00930 Caprolactam degradation
    MAP3658 (echA1_2)
Enzymes [BR:mpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAP3658 (echA1_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4063585..4064379
Genome map
AA seq 264 aa AA seqDB search
MRHVSTGNEEAGEPEVLVEQRDRILIITINRPKAKNAVNAAVANGLAAAVDRLDNEPGLS
VGVLTGAGGSFCAGMDLKAFARGELPIVEGRGMGFTERPPAKPLIAAVEGYALAGGTELA
LATDLIVASKDAAFGIPEVKRGLVAGGGGLLRLPQRIPSAIAMELALTGDNLSAERAHAL
GMVNVLAEPGAALDEAIALAEKIAANGPLAVAATKRIIVESRGWSPETMFAEQNKLLAPV
FSSNDAKEGAIAFAEKRPPKWTGT
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
gtgcggcacgtgagcactgggaacgaagaagccggcgaacccgaggtcctggtcgaacaa
cgggatcggatcctcatcatcacgatcaaccggccgaaggccaagaacgcggtcaacgcc
gcggtggccaacggactggccgccgccgtcgaccggctggacaacgagcccggtctgtcg
gtcggcgtcctgaccggggccggcggctccttctgcgcgggtatggatctgaaggccttc
gcccgcggcgagctgcccatcgtcgagggccgcggcatgggtttcaccgaacgcccgccg
gccaagccgctgatcgcggcggtcgagggttacgcgctggccggcggcaccgagctggcg
ctggccaccgacctgatcgtcgcctccaaggacgcggccttcggcattccggaagtcaag
cgcggcctggtcgccgggggcggcgggctgctgcggctgccgcagcgcatcccgtccgcg
atcgccatggagctggcgctgaccggtgacaacctcagcgccgagcgggcgcacgcgctc
ggcatggtcaacgtgctggccgagccgggtgccgcgctggacgaggcgatcgcgctggcc
gagaagatcgcggcgaacgggccgctggcggtggccgccaccaagcggatcatcgtcgag
tcccgcggctggagcccggagaccatgttcgccgagcagaacaagctgctggcccccgtg
ttctcctccaacgacgccaaggaaggcgccatcgcgttcgccgagaagcggccccccaag
tggacgggcacctga

DBGET integrated database retrieval system