KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3688Help
Entry
MAP3688           CDS       T00156                                 

Gene name
lpqI
Definition
hypothetical protein
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    MAP3688 (lpqI)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    MAP3688 (lpqI)
Enzymes [BR:mpa01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     MAP3688 (lpqI)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4101941..4103107
Genome map
AA seq 388 aa AA seqDB search
MALSRPLAAHAAVLAAVSELMIGCAHRAAPPPAHSSTSNTPAAAPAPRVCVDPPAAPATL
NLRDKLAQLLMVGVKNADDARNVVNGYHVGGIFIGSWTDLTIFRGPLGDIAAKAGPLPLA
VSVDEEGGRVSRLKSLIGTSPSPRELAQTQTVQQVHDLAADRGKKMRDLGITVDFAPVVD
VSDEPDDAVIGNRSFGADPAKVTEYAGAYAQGLRDAGLLPVLKHFPGHGHGSGDSHTGGV
VTPPLDDLQNDDLVPYRTLVTTPPVGVMVGHLQVPGLTGDVPASLSPEAVQLLRNGVGYK
GPPFTGPVFSDDLSSMAAISDRYGVSEAVLRSLLAGVDVALWVTTDEVPAVLDRLQKAVA
SGELPAQRVDESLVRVATMKGRGPACGH
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggcattgtcgcgccccctcgccgcgcacgcggccgtgctggccgccgtgtcggagctg
atgatcggctgcgctcaccgcgccgcacccccgcccgcgcactcgtcgacgtcgaacacg
ccggccgctgccccggcgccgcgggtgtgcgtcgacccgccggcagcgccggccaccctg
aaccttcgcgacaagctggcccaactgctgatggtgggtgtcaagaacgccgacgacgcg
cgcaacgtcgtcaacggctatcacgtcggcggcatcttcatcggcagctggacggacctg
acgatcttccggggcccgctgggtgacatcgcggccaaggcggggccgttgccgctggcg
gtcagcgtcgacgaggagggcggccgggtctcgcggctgaaatccctgatcgggacgtcg
ccgtcgccgcgcgagctggcgcagacgcagaccgtgcagcaggtgcacgacctggccgcc
gaccgcggcaagaagatgcgcgacctgggcatcaccgtcgatttcgcgcccgtcgtcgac
gtcagcgacgagcccgacgacgccgtgatcggcaaccgttcgttcggcgcggacccggcc
aaggtcaccgagtacgccggtgcgtatgcgcaggggctgcgcgacgccgggctgttgccg
gtgctcaagcacttccccggccacgggcacggctcgggcgactcccacaccggtggcgtg
gtcacgccgccgttggacgacctgcagaacgacgacctggtgccctaccggaccctggtg
acgacgccgccggtcggggtgatggtgggccacctgcaggttcccgggctcaccggcgac
gtgccggccagcctgagccccgaggcggtgcagttgctgcgcaacggcgtcggctacaag
gggccgccgttcaccgggcccgtcttcagcgacgatctgtccagcatggcggccatctcc
gaccggtacggggtctccgaggcggtgctgcgcagcctgctggccggcgtcgacgtcgcc
ttgtgggtcaccaccgacgaggtgccggcggtgctggaccggctgcagaaggcggttgcc
tcgggcgaattgccggcccagcgggtggacgagtcgctggtgcgggtggcgaccatgaag
ggccgcggcccggcctgcgggcactag

DBGET integrated database retrieval system