KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3706cHelp
Entry
MAP3706c          CDS       T00156                                 

Definition
bifunctional uroporphyrinogen-III synthetase/response regulator domain protein (EC:4.2.1.75)
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAP3706c
Enzymes [BR:mpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MAP3706c
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4122127..4123278)
Genome map
AA seq 383 aa AA seqDB search
MAPPDSAPLTGYRIAVTSANRAEELCALLRRNGAEVTSAAAINIIALPEDQELHRHTEAV
IAQPPDILVAHTGIGFRGWVAAADGWGLAPQLLSALSQARIVARGPKATGALRAAGLHEE
WSPKSESSREVLRYLLDSGVAGKRIAVQLHGAADGWDPFPEFINGLRSAGAQVMPIHVYR
WKPTPAGGEFDQLVASVARRQFDAVTFTSAPAGAALLERSRELGIEDQLLQALRSDVHAM
CVGPVTAQPLIRAGVPTSSPERMRLGALARHIAQELPPLRSCTLRAAGHQIEIRGTCVLV
DGAVKSLSGSAMATLRALAARPGDVVARNDLLRVLPGNSNDPHAVDTAVLRLRTALGDKN
IIATVVKRGYRLAIDTPDGSAWH
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
ctggccccgccggactccgcgccgctcaccggctaccggatcgccgtcacctcggcgaac
cgggccgaggagctgtgcgcgttgctgcgccgcaacggcgcggaagtcaccagcgccgcc
gccatcaacatcatcgcgctgcccgaggaccaggagctgcaccgccacaccgaggcggtg
atcgcccaaccgcccgatatcttggtggcgcacaccgggatcggcttccgcggctgggtc
gccgcggccgacggctggggcctggccccccaactgctgtcggcgctgtcgcaggcccgg
atcgtggcccgcgggcccaaggcgacgggcgcgttgcgcgccgccgggctgcacgaggag
tggtcgccgaaatccgaatcgtcgcgcgaggtgttgcgctacctgctcgactccggtgtg
gccggcaagcggatcgcggtgcagctgcacggcgcggccgacggctgggatcccttcccg
gagttcatcaatgggcttcgctcggccggcgcgcaggtgatgcccatccacgtctaccgc
tggaagccgacaccggccggcggagaattcgaccaactcgtcgcctccgtggcgcggcgg
cagttcgacgcggtcaccttcacctcggcgcccgccggcgcggcgctgctggagcgcagc
cgcgagctgggcatcgaagaccaactgctgcaagcacttcgcagcgacgtgcacgccatg
tgcgtggggccggtgaccgcgcagccgttgatccgcgcgggtgtgccgacgtcgtcgccg
gagcgaatgcggttgggggcgttggcccgtcacatcgcccaggagttgccgccgctgcgc
tcgtgcacgttgcgggcggccgggcaccagatcgagatccgcggcacctgtgtgctggtc
gacggcgcggtcaagtcgctgtccgggtcggccatggcgacgctgcgcgcgctggcggcg
cgccccggtgacgtggtcgcgcgcaacgacttgctgcgggtgcttcccggcaacagcaac
gacccgcacgccgtcgacacggccgtgctgcggctgcgaacggcgctgggcgacaagaac
atcatcgcgacggtggtcaagcgcggctaccggctggcgatcgacaccccggacggatcg
gcatggcactga

DBGET integrated database retrieval system