KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP3981Help
Entry
MAP3981           CDS       T00156                                 

Gene name
gpmA
Definition
phosphoglyceromutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAP3981 (gpmA)
   01230 Biosynthesis of amino acids
    MAP3981 (gpmA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAP3981 (gpmA)
  Energy metabolism
   00680 Methane metabolism
    MAP3981 (gpmA)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    MAP3981 (gpmA)
Enzymes [BR:mpa01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     MAP3981 (gpmA)
Exosome [BR:mpa04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   MAP3981 (gpmA)
  Exosomal proteins of melanoma cells
   MAP3981 (gpmA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4439757..4440506
Genome map
AA seq 249 aa AA seqDB search
MGETATLVLLRHGESEWNSLNLFTGWVDVGLTDKGRAEAVRSGELLAEQGLLPDALYTSL
LRRAITTAHLALDAADRLWIPVRRSWRLNERHYGALQGLDKAETKARYGEEQFMAWRRSY
DTPPPPIERGSTYSQDADPRYADIGGGPLTECLADVVVRFLPYFTDVIVPDLRSGKTVLI
VAHGNSLRALVKHLDQMSDDDVVGLNIPTGIPLRYDLDARLRPLVPGGTYLDPEAAAAGA
AAVASQGRG
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgggtgagactgccacgctggtactgctgcgccacggcgaaagcgaatggaactcgctg
aacctgttcaccggttgggtggacgtcgggctgaccgacaagggccgcgccgaggcggtg
cgcagcggcgagctgctggccgagcagggcctgctgcccgacgcgctctacacgtcgctg
ctgcgccgcgcgatcaccaccgcgcatctggccctggacgccgcggaccggctgtggatc
ccggtgcggcgcagctggcggctcaacgaacgccactacggggcgctgcagggcctggac
aaggccgagacgaaggcgcgctacggcgaggagcagttcatggcctggcgacgcagctat
gacacgccgccgccgccgatcgagcggggcagcacctacagccaggacgccgatccgcgc
tacgccgacatcggcggcgggccgctgaccgagtgcctggccgacgtggtcgtccggttc
ctgccgtacttcaccgacgtcatcgtcccggacctgcgcagcggcaagacggtgctgatc
gtcgcgcacggcaactcgctgcgcgccctggtcaagcacctcgatcagatgtccgacgac
gacgtcgtggggctgaacatcccgaccggcatcccgctgcgctacgacttggacgcccgg
ctgcggccgctggttcccggcggcacctacctcgaccccgaggcggccgccgccggcgcc
gccgcggttgccagccaggggcgcggctga

DBGET integrated database retrieval system