KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP4004Help
Entry
MAP4004           CDS       T00156                                 

Gene name
cysG
Definition
hypothetical protein
Orthology
K13542  
uroporphyrinogen III methyltransferase / synthase [EC:2.1.1.107 4.2.1.75]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    MAP4004 (cysG)
Enzymes [BR:mpa01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     MAP4004 (cysG)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     MAP4004 (cysG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4464404..4466062
Genome map
AA seq 552 aa AA seqDB search
MTTRGRKPTPGRITYVGSGPGDPGLLTARAATVLANAALVFTDPDVPEPVLALIGKDLPP
VSGPAPAEPASNGEGSGSEQGQAQPAVISGGPDIRPALGDPAEVAKTLTAEARTGVDVVR
LVAGDPLTVDAVITEVNAIARSHLHIEIVPGLAPTNAVPTYAGLPLGSSHTMADVRGDVD
WEALAAAPGPLILQATASHLADAARTLIEHELAENTPCVVTAHGTTCQQRSIETTLQGLT
DSAVLGGTDPAGPLTGPLVVTIGKTVSARTKLNWWESRALYGWTVLVPRTKDQAGEMSER
LTSYGALPIEVPTIAVEPPRSPAQMERAVKGLVDGRFQWVVFTSTNAVRAVWEKFGEFGL
DARAFSGVKIACVGESTADRVRAFGISPELVPAGEQSSLGLLDDFPPYDSVFDPVNRVLL
PRADIATETLAEGLRERGWEIEDVTAYRTVRAAPPPAETREMIKTGGFDAVCFTSSSTVR
NLVGIAGKPHARTIIACIGPKTAETAAEFGLRVDVQPETAAVGPLVDALAEHAARLRAEG
ALPPPRKKSRRR
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgcgagggcgtaagccgacacccggccgcatcacgtacgtgggctccggcccg
ggtgacccgggactgttgacggcccgggccgcgacggtgctggcgaacgccgcgctggtg
ttcaccgaccccgacgtgcccgagccggtgctggcgctgatcggcaaggacctgccaccg
gtgtccggcccggcgccggccgagccggcgtccaacggcgagggctccggctccgagcag
gggcaggcgcagccggcggtgatctccggtggcccggacatccgcccggcgctgggtgat
cccgccgaggtggccaagacgctgaccgccgaggcgcgcaccggtgtcgacgtggtgcgg
ctggtggccggtgacccgctgaccgtcgacgccgtcatcaccgaggtcaacgccatcgcc
cgcagccacctgcacatcgagatcgtgcccgggctggcgcccaccaacgccgtcccgacc
tacgcgggcctgccgctgggctcctcgcacaccatggccgacgtgcgcggtgacgtggac
tgggaggcgctggccgccgcgcccggcccgctgatcctgcaggccaccgcgtcgcacctg
gccgacgcggcgcgcaccctgatcgaacacgaactggccgagaacaccccgtgcgtggtc
accgcgcacggcaccacctgccagcagcgctccatcgagaccacgctgcaggggctgacc
gactcggcggtgctgggcggcaccgaccccgccggcccgctgaccggtccgctggtggtg
accatcggcaagacggtgagcgcccggaccaagctgaactggtgggagagccgcgccctg
tacggctggaccgtgctggtgccccgcaccaaggaccaggccggcgagatgagcgagcgg
ctgacgtcgtacggcgcgctgccgatcgaggtgccgaccatcgccgtcgagccgccgcgc
agccccgcgcagatggagcgtgccgtcaagggattggtcgacggccgcttccagtgggtg
gtgttcacctccaccaacgcggtgcgcgcggtgtgggagaagttcggcgagttcggtctg
gacgcgcgcgcgttctccggggtgaagatcgcctgtgtgggcgagtcgacggccgaccgg
gtgcgggcgttcgggatcagccccgagctggtgccggccggcgagcagtcctcgctgggt
ctgctcgacgacttcccgccctacgacagcgttttcgacccggtgaaccgggtgctgttg
ccgcgggccgacatcgccaccgagacgctggccgaggggctgcgcgaacggggttgggag
atcgaggatgtcacggcctaccggacggtgcgggccgcgccgccgccggcggagacccgg
gagatgatcaagaccggcggcttcgacgcggtgtgcttcacgtccagctccacggtgcgc
aacctggtcggcatcgccggcaagccgcacgcccggacgatcatcgcctgcatcggtccc
aagaccgccgagaccgccgccgagttcggcctgcgggtggatgtccagcccgagaccgcg
gcggtgggcccgctggtcgacgctctggccgaacacgccgcgcggttgcgcgccgagggg
gcgctgccaccgccgcgcaagaagagccgcaggcgctag

DBGET integrated database retrieval system