KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP4123Help
Entry
MAP4123           CDS       T00156                                 

Definition
hypothetical protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    MAP4123
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    MAP4123
   00052 Galactose metabolism
    MAP4123
   00500 Starch and sucrose metabolism
    MAP4123
   00520 Amino sugar and nucleotide sugar metabolism
    MAP4123
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    MAP4123
   00524 Butirosin and neomycin biosynthesis
    MAP4123
Enzymes [BR:mpa01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     MAP4123
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4596576..4597496
Genome map
AA seq 306 aa AA seqDB search
MLTLGLDIGGTKIAAALVDSVGTLVHTAVRPTPNPAPADDVWDVVHALIAEVVRAAGAPI
AAVGIASAGPVDLPSGSVSPINIAGWHRFPLRDKVAAAVPATPVVLGGDGLCMALGEQWL
GAGRGARFLLGMVVSTGVGGGLVLDGAPYPGRTGNAGHVGHVVVELDGRPCTCGGHGCVE
TVASGPSMVRWARENGWSAAPGAGARDLAAAAASDPLAQKAFHRSADALAAMIASVGAVC
DLDVVVIGGGVAQSGPLLFDPLRERLAHYAGLDFLSGLTVVPGELGGNAGLIGAARLATL
ARPAGS
NT seq 921 nt NT seq  +upstreamnt  +downstreamnt
atgctcaccctcggcctggacatcggcggcaccaaaatcgctgccgcacttgttgattcg
gtcggcacgctggtccacaccgctgtccgccccacccccaacccggccccggccgacgat
gtgtgggatgtggtgcacgccctgatcgccgaggtggtgcgggcggccggcgccccgatc
gcggccgtgggtatcgcgtcggcggggcccgtcgacctgcccagcggatccgtcagcccg
atcaacatcgccggctggcaccgtttcccgttgcgcgacaaggtcgccgcggcggtgccc
gcgacaccggtggtgctgggcggcgacgggctctgcatggcgctgggggagcagtggctg
ggcgcgggacgcggcgcccgtttcctgctgggcatggtggtctccacgggggtgggtggc
ggcctggtgctcgacggcgccccctacccgggccgcaccggcaacgccggtcacgtcggg
cacgtggtggtcgaactggacggccggccctgcacctgcggcgggcatggctgcgtggag
acggtggcctccgggccgtcgatggtgcgctgggcgcgcgaaaacgggtggtcggcggcg
ccgggggccggcgcccgggacctggccgccgccgcggcctcagacccgttggcgcagaag
gcgtttcaccggtcggccgacgcgctcgcggcgatgatcgcctcggtcggtgcggtgtgc
gatctggacgtggtggtgatcgggggaggcgtcgcccagtccgggccgctgctgttcgac
ccgctgcgcgaaaggctggcccactacgccgggctggacttcctgtccgggctgacggtg
gtgccgggggaactcggcggcaatgccgggctgatcggcgcggcccggctggcgaccctg
gcgcgacccgccggctcctag

DBGET integrated database retrieval system