KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP4134Help
Entry
MAP4134           CDS       T00156                                 

Gene name
echA4
Definition
enoyl-CoA hydratase (EC:4.2.1.17)
Orthology
K01692  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Phenylalanine metabolism
Benzoate degradation
Tryptophan metabolism
beta-Alanine metabolism
Aminobenzoate degradation
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    MAP4134 (echA4)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    MAP4134 (echA4)
   00650 Butanoate metabolism
    MAP4134 (echA4)
  Lipid metabolism
   00071 Fatty acid degradation
    MAP4134 (echA4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAP4134 (echA4)
   00310 Lysine degradation
    MAP4134 (echA4)
   00360 Phenylalanine metabolism
    MAP4134 (echA4)
   00380 Tryptophan metabolism
    MAP4134 (echA4)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    MAP4134 (echA4)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    MAP4134 (echA4)
   00281 Geraniol degradation
    MAP4134 (echA4)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAP4134 (echA4)
   00627 Aminobenzoate degradation
    MAP4134 (echA4)
   00930 Caprolactam degradation
    MAP4134 (echA4)
Enzymes [BR:mpa01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     MAP4134 (echA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4613382..4614320
Genome map
AA seq 312 aa AA seqDB search
MTHAIRPVDFDNLKTMTYEVTDRVARITFNRPEKGNAIVADTPLELSALVERADLDPNVH
VILVSGRGAGFCAGFDLSAYADRTGSAGGTGAYAGTVLDGKTQAVNHLTDQPWDPMIDYQ
MMSRFVRGFSSLMHADKPTVVKIHGYCVAGGTDIALHADQVIAAADAKIGYPPTRVWGVP
AAGLWAHRLGDQRAKRLLFTGDCITGAQAAEWGLAVEAPDPADLDERTERLVQRIAAVPV
NQLIMVKLALNSALLQQGVATSRMVSTVFDGVARHTPEGHAFVADAVKHGFREAVRHRDE
PFGDHGRQASQV
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacccacgcgatcaggccggtcgacttcgacaacctgaaaacgatgacctatgaggtc
accgaccgggttgcccggatcaccttcaaccgcccggagaagggcaacgcgatcgtcgcg
gacaccccgctggagctctccgcgctggtggagcgggccgacctggatcccaacgtgcac
gtcatcctggtctccggccgcggcgcgggtttctgcgcgggcttcgacctgagcgcctac
gccgatcgcaccggctcggccggcgggaccggtgcctacgcgggcaccgtgctggacgga
aaaacccaggcggtcaaccatttaaccgatcagccgtgggacccgatgatcgactatcag
atgatgagccgtttcgtgcggggcttctcctccctgatgcacgccgacaaaccgacggtg
gtcaagatccacggctactgcgtggccggcggcaccgacatcgcgttgcacgccgaccag
gtgatcgccgccgccgacgccaagatcggctacccgccgacgcgggtgtggggcgtgccg
gccgccggcctgtgggcgcaccggctgggcgatcagcgcgccaagcggctgctgttcacc
ggcgattgcatcaccggcgcgcaagccgccgaatggggtctggccgtcgaggcgcccgat
ccggccgatctcgacgagcgcaccgagcggctagtgcagcggatcgcggcggtgccggtc
aaccagctgatcatggtcaagctcgcgctgaattccgctctgctgcaacagggggtggcc
accagccggatggtcagcacggtgttcgacggcgtcgcccggcacaccccggagggccac
gccttcgtcgccgacgccgtgaagcacggattccgtgaggcggtgcggcatcgcgacgaa
ccgttcggcgaccacggccggcaggcctcgcaggtgtag

  All links  
No link information was found.   
DBGET integrated database retrieval system