KEGG   Mycobacterium avium subsp. paratuberculosis K-10: MAP_2436cHelp
Entry
MAP_2436c         CDS       T00156                                 

Gene name
fadA4
Definition
(GenBank) FadA4
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
mpa  Mycobacterium avium subsp. paratuberculosis K-10
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:mpa00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    MAP_2436c (fadA4)
   00630 Glyoxylate and dicarboxylate metabolism
    MAP_2436c (fadA4)
   00640 Propanoate metabolism
    MAP_2436c (fadA4)
   00650 Butanoate metabolism
    MAP_2436c (fadA4)
  Lipid metabolism
   00071 Fatty acid degradation
    MAP_2436c (fadA4)
   00072 Synthesis and degradation of ketone bodies
    MAP_2436c (fadA4)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    MAP_2436c (fadA4)
   00310 Lysine degradation
    MAP_2436c (fadA4)
   00380 Tryptophan metabolism
    MAP_2436c (fadA4)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    MAP_2436c (fadA4)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    MAP_2436c (fadA4)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    MAP_2436c (fadA4)
Enzymes [BR:mpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     MAP_2436c (fadA4)
Exosome [BR:mpa04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   MAP_2436c (fadA4)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2736327..2737496)
Genome map
AA seq 389 aa AA seqDB search
MIVAGARTPIGKLMGSLKDFSASDLGAIAIAGALEKADVPADLVEYVIMGQVLTAGAGQM
PARQAAVAAGIGWDVPALSINKMCLSGIDAIALADQLIRAGEFDVVVAGGQESMTKAPHL
LMDSRAGYKYGDVTVLDHMAYDGLHDVFTDQPMGALTEQRNDVDKFTREEQDQYAARSHQ
RAAAAWKDGVFTDEVVPVNIPQRKGDPLQFTEDEGIRANTTAESLAGLKPAFRKDGTITA
GSASQISDGAAAVVVMSKAKAQQLGLSWLAEIGAHGVVAGPDSTLQSQPANAIKKALGRE
GISVDQLDVVEINEAFAAVALASTRELGVNPDIVNVNGGAIAVGHPIGMSGARITLHAAL
ELSRRGSGYAVAALCGAGGQGDALILRAG
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgttgctggagcgcggacacccatcggcaagctgatgggttcgctgaaggatttc
tccgccagcgacctgggtgccatcgccatcgccggcgcgctggagaaggccgacgtcccg
gccgacctggtcgagtacgtgatcatggggcaggtgttgacggccggggccggtcagatg
ccggcccggcaggcggccgtggcggccggcatcggctgggacgtgccggcgttgagcatc
aacaagatgtgtctgtccgggatcgacgccatcgccctggccgaccagctgattcgcgcc
ggagagttcgacgtggtggtagccggcggtcaggagtcgatgaccaaggcgccgcacctg
ctgatggacagccgcgcgggctacaagtacggcgacgtgacggtcctggaccacatggcc
tacgacggcctgcacgacgtgttcaccgaccagccgatgggcgcgctcaccgagcagcgc
aacgacgtcgacaagttcacccgcgaagagcaggaccagtacgccgcacggtcgcatcag
cgggcggccgcggcgtggaaggacggcgtgttcaccgacgaggtggtgccggtgaacatc
ccgcagcgcaagggcgatccgctgcagttcaccgaggacgagggcatccgcgccaacacc
accgccgagtcgctggccggcctcaagccggcgttccgcaaggacggcaccattaccgcc
gggtcggcctcgcagatctccgacggcgcggccgcggtggtcgtgatgagcaaggccaag
gcccagcagctcgggctgagctggctggccgagatcggtgcgcacggggtggtcgccgga
ccggactccaccctgcagtcgcagccggccaacgccatcaagaaggcgctcggtcgcgag
ggcatctccgtcgaccagctcgacgtggtggagatcaacgaggcgtttgcggccgtggcg
ctggcctcgacccgcgaactcggcgtgaatcccgacatcgtcaacgtcaacggcggtgcg
atcgcggtcgggcacccgatcgggatgtcgggggcgcggatcaccctgcatgccgcgctg
gaactgtcgcggcgcggctcgggctacgcggtcgcggccctgtgcggggccggcgggcag
ggcgacgcgctgattctgcgggcgggttag

DBGET integrated database retrieval system