KEGG   Marinomonas posidonica: Mar181_0019Help
Entry
Mar181_0019       CDS       T01508                                 

Definition
(GenBank) 3'(2'),5'-bisphosphate nucleotidase
  KO
K01082  3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00920  Sulfur metabolism
mpc01100  Metabolic pathways
mpc01120  Microbial metabolism in diverse environments
mpc01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Mar181_0019
Enzymes [BR:mpc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Mar181_0019
Transfer RNA biogenesis [BR:mpc03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Mar181_0019
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Inositol_P
Motif
Other DBs
NCBI-ProteinID: AEF53088
JGI: Mar181_0019
UniProt: F6CYW1
Position
22475..23341
Genome map
AA seq 288 aa AA seqDB search
MQDVNQHPVFQALQKIIHDAATAIMEIYQSADLGIQQKSDDSPVTAADLAAHRIILSGLQ
ALTPDIPVLSEEGTVKFEERVHWPSLWIVDPLDGTKEFIKRNGEFSINIALVQDGRPIVG
MVYLPTTLEGYFGVTEAWQDLPVGAIKWHDDVEHEATYESINVRVPREPIIVMTSRSHGP
ALPIDLKDTLKANYEQVRELPKGSSIKGCRIAEGIADLHLRRGPTSEWDTAAQQAIIEAA
GGMLVTPEGKPFRYNQRETLLNGHFFVSGNEIAPHIMRWYENKDSEID
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgcaggacgttaatcaacaccccgtttttcaagcgctacaaaaaataatacacgatgca
gccacagcgatcatggaaatttatcaaagtgccgatttggggattcagcagaagtctgat
gacagtcctgttacggcggctgacttggcggcacaccgtattattttatcaggtttgcaa
gcacttacaccggacatacctgtcttatcagaagaaggtacggtgaaatttgaagagcgt
gtgcactggccgtctctttggatcgttgaccctttagatggcaccaaagaattcattaag
cgaaatggtgagttcagtatcaacattgcattagttcaagacggcagaccaattgtgggc
atggtgtatttgcccacgacactggaaggctattttggtgtcacggaggcttggcaagat
ttgcctgtcggagcgataaaatggcacgacgacgttgagcatgaagccacgtatgaatct
atcaatgtcagagtgccaagagagcctattattgtcatgaccagtcgcagccatggccct
gccctgcctatcgatttaaaagacaccttaaaggctaactatgagcaagtaagagagttg
ccaaaaggcagttccattaagggttgtcgtattgccgaaggcattgccgatttgcattta
cgacgtggtccaaccagtgaatgggatacggcggcccaacaagccattatcgaggctgcg
ggtggtatgctggtcacaccagaaggaaagccatttcgatacaatcaaagagagacctta
ttaaatggtcatttctttgtctctggtaatgaaattgcgccacacattatgcgttggtat
gaaaacaaagacagtgagatagactaa

DBGET integrated database retrieval system