KEGG   Marinomonas posidonica: Mar181_0282Help
Entry
Mar181_0282       CDS       T01508                                 

Definition
F420-dependent oxidoreductase
Orthology
K12234  
coenzyme F420-0:L-glutamate ligase / coenzyme F420-1:gamma-L-glutamate ligase [EC:6.3.2.31 6.3.2.34]
Organism
mpc  Marinomonas posidonica
Pathway
Methane metabolism
Microbial metabolism in diverse environments
Class
Metabolism; Energy metabolism; Methane metabolism [PATH:mpc00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
309627..310400
Genome map
AA seq 257 aa AA seqDB search
MPDSMSMFRLMGLPDFQSGDDLAQNIIDTLSIQNQRLQQGDILVIAHKVVSKTEGACVYL
ADVTPSKEAIELAKTVNKDPRKVEVILSQSNRIVRAMKRPDQQEGVLIAEHKKGYICANA
AVDESNADHPGQLILLPEDPDKSANALCQRLEAHFQCELGVVISDTFGRPWRLGQTNVAI
GLANVPGVMHMQGEVDAFGRPLSVTAPAFADELAAASGLLMAKSAKSPVILFRGLDWPKT
QSSSRDLIRSHNEDLFR
NT seq 774 nt NT seq  +upstreamnt  +downstreamnt
atgcctgattctatgagcatgtttcgtttgatggggttaccggattttcaatcaggtgat
gatctcgcgcagaatattattgataccttatcgatacaaaatcaacgtttgcagcagggc
gacattctggtgattgcacacaaggtggtatccaaaacagaaggagcttgtgtctatcta
gcggatgtaacgcccagtaaggaagccattgagctggcgaaaacagtgaataaagatccg
cgtaaagtggaagttatcttgtctcagtcgaatcgtattgtgcgtgcgatgaaacggcca
gatcagcaagaaggcgtgctgattgcagagcataaaaaaggctacatctgtgccaatgca
gcggtggatgaatccaatgcggatcatcctgggcaattgatcttattgcctgaggaccct
gataaaagtgcgaacgcattatgtcagcgcttggaagcacattttcaatgtgagttaggc
gtcgtgatcagcgatacctttggtcgcccttggcgcttaggtcaaaccaatgtggctatc
ggtctagccaatgtacctggggtcatgcatatgcagggagaagtcgatgcctttggtcgc
ccgttgagtgtcacagcccctgcgtttgctgacgaactggcggccgcgtcaggtcttttg
atggcaaaaagcgccaagtccccagtgattctttttcgaggcctagattggccaaaaaca
cagagctcaagtcgagaccttatccgttcacataacgaggatttatttagatga

DBGET integrated database retrieval system