KEGG   Marinomonas posidonica: Mar181_0305Help
Entry
Mar181_0305       CDS       T01508                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
mpc  Marinomonas posidonica
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mpc00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(337030..337512)
Genome map
AA seq 160 aa AA seqDB search
MTAYIGLGSNLDQPLEQIRQAIQTLAKQPSLNNLRISKLYASKPVGPQDQPDYVNAVASF
ETSLSGIELLDLLQSIEQDHHRLRERHWGPRTLDLDLLLYGQEQIDLPRLTVPHPFMLER
GFVIQPLHDLAPDMLLVNGTTVTEQLHQLDTSDLVIITEE
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgacagcttacattggtcttggcagtaatcttgatcagccacttgagcagattcgccaa
gccatccaaactcttgctaaacagccgagtttgaacaatttgagaatatctaaactgtac
gccagcaaaccggttggtccacaagatcaaccggattatgtgaatgcagttgcgtcattc
gaaacgtcattatctggcatcgaattattggatctactgcaatccattgaacaagatcat
cacaggcttcgcgaacgtcattggggaccgcgcaccttagatttagatctgttattgtat
ggacaagagcagattgatttaccaagattgactgtgccacatccttttatgcttgaacga
ggctttgtcatccaacctcttcatgatcttgctcccgatatgctcttggtgaatggcaca
accgttaccgagcagttacaccaacttgataccagcgacttggttattatcacagaagaa
taa

DBGET integrated database retrieval system