KEGG   Marinomonas posidonica: Mar181_0372Help
Entry
Mar181_0372       CDS       T01508                                 

Definition
glycerol kinase (EC:2.7.1.30)
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
mpc  Marinomonas posidonica
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Mar181_0372
Enzymes [BR:mpc01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Mar181_0372
Exosome [BR:mpc04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Mar181_0372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
414555..416039
Genome map
AA seq 494 aa AA seqDB search
MTHYILAIDQGTTSSRAIVFDEKANRIGQSQQEFPQIFPNDGWVEHDPEAIWSSTLAVCQ
SVLKDTGIAAQEIASVGITNQRETTILWDITTGKPVYNAIVWQDRRTSVYCQSLVDQGWA
NKVQEKTGLLIDPYFSATKIRWVLENVEGAKQKAQAGQLAFGTVDSYLLWHLTKGQSHKT
DATNAARTMAFNIHQQEWDQELIALFGIEDVIFPEVMDCSADFGDIDAQWLGASIPVNGV
AGDQQAALVGQACFTPGMVKSTYGTGCFMILNTGEQALKSEHKLLTTVGYRLNGKVTYAL
EGSIFVAGAAIQWLRDGLKLFSDAKETQNLAQKALNDDSVYLVPAFTGLGAPYWDPDARG
AMIGLTRDTSVEDIVSAGLRSVCYQTRDLVDAMAQDGANFRFLRVDGGMVVNDIMVQFLS
DLLDVTVERPCVTETTALGVAFLAGMKVGIYQSLEEISHLWEADKTFQPEMDKAAGDTLY
KGWQKAVNRVRTKT
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atgactcattatattcttgcgatcgatcaaggtaccaccagttcacgcgccattgtattc
gatgaaaaagcgaaccgtattggccagtctcagcaagaatttcctcaaatctttcctaat
gatggttgggtagagcatgacccagaagccatttggtcttcaaccctagccgtttgtcaa
tctgtgcttaaggatacaggcatcgccgcgcaagagatagccagtgtcggtatcaccaat
caaagggaaaccaccattctttgggacataacgaccggcaagcctgtttacaatgccatc
gtttggcaggatcgacgcaccagtgtttattgtcaatctttggttgatcaaggttgggcg
aacaaggttcaagaaaaaacgggattgttgatcgacccatatttttcggccactaagata
cgttgggtgttggagaatgttgaaggggcgaaacaaaaagcacaggcaggtcaattggcg
tttggtacggtagacagctatttgctttggcatttgacaaaagggcaatcccataagacg
gatgcaaccaatgcggctcggacgatggcgttcaacattcatcagcaagaatgggatcaa
gaactgatagcgttgtttggcattgaggacgtgatttttcctgaagtgatggattgcagc
gctgattttggtgacattgatgcacagtggctaggtgccagtattcctgtgaatggggtt
gcaggagatcaacaagctgccctagttggtcaggcgtgctttacaccaggcatggtgaaa
agcacctatgggactggctgctttatgatccttaatacaggtgagcaagcacttaaatcg
gaacacaagctactcactacggtggggtatcgccttaatggaaaagtgacttatgcgcta
gaaggtagcattttcgttgctggtgcggcgatccagtggttgcgcgatggtctaaaactg
ttcagtgatgccaaagaaacgcaaaatttggcgcaaaaagcgttgaacgatgattcggtt
tatttggtgcctgcctttacgggcttgggtgccccttactgggatcctgatgcgcgtggt
gccatgataggtttgactcgtgataccagcgtagaagacattgttagtgctggtttgcga
tctgtgtgctatcaaacgcgagatctggtggatgcaatggcacaagacggagccaatttc
cgtttcctgcgggtggatggtggtatggtcgttaatgatattatggtgcaatttctaagt
gatttgttagacgtcaccgtagagcgaccttgtgtcacagaaaccacagcgttgggtgtg
gcgtttttggccggtatgaaggttggaatttatcaatctctagaggaaattagtcatttg
tgggaagccgataaaaccttccagccagaaatggataaggctgcaggcgatactttgtat
aagggctggcagaaggcggtgaaccgagttcgaaccaagacttaa

DBGET integrated database retrieval system