KEGG   Marinomonas posidonica: Mar181_0447Help
Entry
Mar181_0447       CDS       T01508                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
mpc  Marinomonas posidonica
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mar181_0447
   00500 Starch and sucrose metabolism
    Mar181_0447
Enzymes [BR:mpc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Mar181_0447
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
492952..494052
Genome map
AA seq 366 aa AA seqDB search
MKGFHAVVSLEGQEGAFSNVQAALDAAPKDDSLYRIYITSGRYHERIGITRNNLEIIGSG
CSEVVIYGAVCAGMLKEAGHIASTLGSRIIEIDAVNVTLKRLTVINQWDYIANALKSDQD
PSKQQHTQAVALLINEHSDQVLLEEVCLDSYQDTFCAQGGRSYLKACKISGNIDFVFGSG
CTLLESCELVCKSYPSQDKVLGYVAAPSTNKLQEYGLVFLRCSIYRENIDLYASSEEKTY
ALGRPWHPTKTFDDGRYADPDAIGVAMYIECELEGHIFGWDKMYGLARDGTKRYFEPDKH
ARFYEWRNTGSGALHSGYKGLWPKAECFSNLGQEFAQALRQDVLGDWALLFNFPSKSSRL
NRPSSK
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgaaaggttttcatgcggtggtatctctggagggtcaagaaggtgctttttctaacgta
caagcagcattagatgcggcaccaaaggatgattcgctgtatcgcatctatatcacatca
ggtcgatatcacgagcgcattggtataactcgaaataatttagaaataattggatctggg
tgttctgaagtggtgatttatggtgctgtgtgcgctggcatgctgaaagaagctggtcat
atcgcgagtactcttggcagtcgaattatcgaaattgatgctgttaatgtcaccttgaaa
cgcctgacggtcattaatcagtgggactacattgctaatgctctgaagtcagatcaagat
ccaagcaagcagcaacatacacaagccgttgctttgcttatcaatgagcacagtgatcaa
gttttactagaagaggtctgtttagatagctaccaagataccttctgtgctcagggtgga
agaagttacctgaaagcctgcaagatcagcggtaacatcgactttgtattcggttcaggt
tgtacattgttggaatcatgtgaattggtgtgtaagtcttatcctagtcaagataaggtg
cttgggtatgtagccgctcccagcacaaataagcttcaggaatatggattggtttttcta
cgatgtagtatttatcgtgaaaatattgatctttatgcttcatctgaggagaaaacctat
gccttggggcgaccttggcacccaaccaagacatttgatgatggtcgttatgctgatcca
gatgcgataggcgttgccatgtacatagagtgtgaattagaagggcatatatttggttgg
gacaaaatgtatggtttggcaagggacggtacaaaacgttattttgaaccggataagcat
gctcgcttttatgagtggcgtaatacgggcagcggggctctgcattctggttataaagga
ctgtggccaaaagcagagtgtttttccaacttaggtcaggaattcgctcaagcattacgt
caggatgttttgggagactgggcgttgttgtttaattttccctctaagtcttcacgtctt
aataggccatcctctaagtaa

DBGET integrated database retrieval system