KEGG   Marinomonas posidonica: Mar181_0456Help
Entry
Mar181_0456       CDS       T01508                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mpc  Marinomonas posidonica
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(501143..502678)
Genome map
AA seq 511 aa AA seqDB search
MTESSSDKLIEVLRKAVSRTSMLAEGNYPELDSVVRQLRQSITQGVNADEIQKLLNQAEP
LLLSSDKAQEERAKLVRTSLQSLIDVLGKNANQPLPAPLKKQLEYEIRSKWQLPYEWPNL
LKLFLELSQQTFNQTDSSHQTEKNSLFQRLFNRSKDKDQAQSNDQEIMVQISHTLAGLVD
NLSLPKRYHGEMSTLKSALTGNSNLEQLPTLLDEVISLVMIAIGKTQESLTKYLSELNKQ
LASINASVTSSYQSQKSLSESREGFNSKLQKQVEETSQAVQGANDLESLQNLINERLSSI
SNTMSEYRSRMQEQEKDANQSITSLKNKVTRMEKDSASLRTMLQEKLAQAMTDALTEIPN
RTAYQDAILPLCQIMQKTQKPLCLAVCDIDFFKKVNDTWGHLAGDKVLSIVPKQIRSVLQ
KEDLIFRYGGEEFVVVFPNTPLDKAMEKAELIRQTVEKTPFNMQGEPVSISVSIGLAQHK
AQETPESLFERADKQLYQAKDSGRNRVMAEK
NT seq 1536 nt NT seq  +upstreamnt  +downstreamnt
atgacggagtcatcaagcgataaattgattgaagttctacgcaaagccgtttctagaact
agcatgctcgctgaaggaaattaccccgagcttgattccgtcgtccgccaacttaggcaa
agcattacccagggtgttaatgctgacgaaatacaaaaacttctcaatcaagctgagccg
ttattactcagcagcgataaagcacaggaagaaagagccaaactggttcgaacctcctta
caaagcctgatcgacgtattaggcaaaaatgccaaccaacctcttcctgcgcctttaaaa
aaacaactggaatacgaaattcgtagcaaatggcaattaccttacgaatggccaaatctg
cttaaattgtttttagaattgagccaacaaacctttaatcaaacggattcaagccatcag
actgagaaaaactccctattccagcgcttgtttaatcgcagcaaagacaaggatcaagct
cagtccaacgatcaagaaatcatggtgcaaatcagtcacaccttagctgggttggtggat
aatttatctctgccaaaacgttatcacggtgaaatgagcacattaaaaagtgccctaaca
ggcaacagtaatctagaacaattaccgactttgctggatgaagtcatttccttggtgatg
attgccatcggcaaaacccaagaaagcctgaccaaatacctgagtgaactgaacaaacaa
ctggcgagtattaacgcttcagtcaccagcagttatcagtcacaaaagtccctgtcagaa
agtcgtgaaggttttaattcaaaattacaaaagcaagtcgaagaaaccagccaagccgtt
caaggtgcaaatgacttagaaagcttgcaaaatttaatcaacgagcgtttatcgagcatt
tccaacaccatgtctgaatatcgctcacgtatgcaagagcaagaaaaagacgccaatcag
tccattactagcctgaaaaacaaagtcactcgcatggaaaaagattccgcctcgttgcgt
actatgctgcaagaaaaattagcacaagccatgaccgatgcgttgactgagatcccaaac
cgtactgcgtatcaagatgccatcttacccctttgccagatcatgcaaaaaacccaaaag
ccgttgtgtttagctgtatgcgatatcgacttctttaaaaaagtcaacgacacctggggg
catttggccggcgacaaagtccttagcattgtgccaaagcaaattcgcagcgttttacaa
aaagaagacctgatttttcgctatggtggcgaagagtttgttgttgtttttcccaacaca
cctcttgataaagccatggagaaagccgaactcattcgtcagaccgttgaaaaaaccccg
ttcaatatgcagggcgagccggtatcgatttcagtgtccattggtcttgctcagcacaaa
gcacaagagacacctgaaagcttatttgaacgggcagataaacagctgtatcaagcgaaa
gattctgggcgtaatcgcgtgatggccgaaaaatag

DBGET integrated database retrieval system