KEGG   Marinomonas posidonica: Mar181_0577Help
Entry
Mar181_0577       CDS       T01508                                 

Definition
(GenBank) Glutaminase
  KO
K01425  glutaminase [EC:3.5.1.2]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00220  Arginine biosynthesis
mpc00250  Alanine, aspartate and glutamate metabolism
mpc00471  D-Glutamine and D-glutamate metabolism
mpc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Mar181_0577
   00220 Arginine biosynthesis
    Mar181_0577
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    Mar181_0577
Enzymes [BR:mpc01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     Mar181_0577
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glutaminase
Motif
Other DBs
NCBI-ProteinID: AEF53634
JGI: Mar181_0577
UniProt: F6D0B2
Position
complement(629149..630060)
Genome map
AA seq 303 aa AA seqDB search
MEALLQSIEKKVRPLIGQGKVADYIPALAQVDPNQFGIAIYSNDGALYQAGQADTEFSIQ
SISKVFSLTLAIKHYGEDMWQRVGREPSGNPFNSLVQLEYESGVPRNPFINAGALVISDM
NQSRFAAPHYAMREFIRRLADNPNITSDKLVSDSEYEFRARNASMAYLMKAFGNFDNDVE
AVLHNYFDNCAVRMNCIDLAKAFSFLANKGFSQHSNEQILSPRETTQVNGLLATSGLYDE
AGNFAYRVGLPGKSGVGGGIIAIVPNQFSMCVWSPELNKSGNSLAGMAALEALSESIGWS
VFG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
gtggaagccttacttcagtccattgaaaagaaagttcgtcccttaatcggtcaaggaaaa
gtcgcagattacattccagcattagcgcaagtggatcctaatcagtttggtatcgccata
tacagtaacgatggtgccctatatcaagcaggccaagcggacactgaattctccatacaa
agtatctcgaaagtgtttagcctaaccctcgccataaaacattatggcgaagacatgtgg
caacgggtggggcgagagccttctggcaacccttttaactcgcttgtgcagttagaatac
gagtcaggcgtcccacgaaaccctttcatcaatgctggtgctttggtcattagtgacatg
aaccaatcgcgctttgctgctccacattatgccatgcgggaatttatccgacgtctagcc
gataacccaaacattacatcagacaaattagtgtccgattcagagtacgagtttcgagct
cgtaacgcatcaatggcgtatttaatgaaagcctttggcaattttgataatgatgtggaa
gctgttcttcacaactacttcgataactgtgcggtgcgcatgaactgcattgatctggcc
aaagccttcagttttctagccaataaaggcttctctcaacacagtaatgaacagatacta
agtccaagagaaaccacccaagtgaatggcttattggctaccagcggtctttatgatgaa
gctggaaactttgcctatcgtgttggtttaccaggcaaaagtggtgtcggtggtggcatc
attgccattgtgccaaatcaattttccatgtgcgtttggtcccctgaattgaacaaatcc
ggtaactctttagcgggtatggcggcactggaagccctatcggaaagcatagggtggtcg
gtgtttggttaa

DBGET integrated database retrieval system