KEGG   Marinomonas posidonica: Mar181_0605Help
Entry
Mar181_0605       CDS       T01508                                 

Definition
disulfide bond isomerase DsbC/G
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mpc  Marinomonas posidonica
Brite
Enzymes [BR:mpc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Mar181_0605
Secretion system [BR:mpc02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Mar181_0605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
654379..655095
Genome map
AA seq 238 aa AA seqDB search
MKHIFSFLVRTLCTFGLMLPFTSSFADQDQVRQSLQTALPQYTIGSIEWHEQAGMYKAEV
KGGPTLYVTKNAQYFVVGDLYRVAADGLVNETEQAKLAKLESLPESDMVVFKADNEKTHI
TVFTDVDCGYCRMLHNDVPILNEMGITVRYLAYPRAGIGSLAYRKMVSIWCSDDPKKWIT
EAKMGAEVPENKCVNPVAEQYQLGVSLGVRGTPSIISKEGVFMPGYLPPQELASKLGL
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaacacatcttttctttcttggtccgtacactttgtacgtttggactaatgcttcct
tttacttcatcttttgccgaccaagatcaagttcgtcaatcactacagacagcgttacct
caatatactattggctcgatagagtggcatgaacaagctggaatgtataaggcggaagta
aagggtgggccaacgctttatgtcactaaaaatgctcaatatttcgttgtaggtgattta
tatcgagtggcggctgatggtttagtgaatgagactgaacaggccaaacttgctaagttg
gaatccttgcctgagtctgacatggtggtgtttaaggcagataatgaaaaaactcatatt
actgtctttacggatgtcgactgtggttattgccggatgctgcataacgatgtaccaatt
ttaaatgagatgggaattacggtgcgttatttagcctacccaagagccggtattggttct
ttagcttatcgtaaaatggttagtatctggtgttctgatgatcctaaaaagtggataact
gaagctaaaatgggggcagaggtgccagagaataagtgtgttaatccggtggctgagcaa
tatcaacttggagtgtctttgggtgtacgaggtacgccgagcattatttcgaaagaaggg
gtgtttatgccaggctatctgcctccgcaagagttggccagtaagctagggttatag

DBGET integrated database retrieval system