KEGG   Marinomonas posidonica: Mar181_0607Help
Entry
Mar181_0607       CDS       T01508                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mpc  Marinomonas posidonica
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mar181_0607
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mar181_0607
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Mar181_0607
Enzymes [BR:mpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Mar181_0607
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
656548..657933
Genome map
AA seq 461 aa AA seqDB search
MKYISTRGKAPALSFGDVLLAGLANDGGLYVPETLPHYSKDEIASWASLSYQELAFKVMW
PFVEGDIPAEEFKSMIEEAYAGFNHESIAPMVQVGNNEWVLELFRGPTLAFKDFALQLLG
RLMDYVLAKRNEKLVIMGATSGDTGSAAIEGCRHSEHLSIFILHPYQRVSEVQRRQMTTV
IDDNVFNVAVKGNFDDCQGMVKSSFADQSFLKGAKLGAVNSINWARIMAQIVYYFSSALA
VGGPHRNVSFSVPTGNFGDIFAGYLAKKMGLPVDQLVVATNQNDILHRVIAENDMSRQAL
NVTLSPSMDIMVSSNFERLLFDAHGRNGAEIDDLMARFNKGDVSLNDQAWSFVKENFDSY
KVDDKRTCEVITEVHDSAQYLLDPHTAIGLEAARQCWKDKSVPMITLATAHPVKFPEAVE
KAGCDLPNLPEHMKDLFEREESYSVLDNELTQVQSFVAERI
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacatttcaactcgtggaaaagcaccagccctttcatttggtgatgtgctatta
gctggtctagcaaatgatggcggtttatatgtgccagagactttgcctcattacagtaaa
gatgaaattgcctcttgggctagcctcagctatcaggaattggcttttaaagtaatgtgg
ccttttgttgagggagacattcctgccgaggaatttaagtcgatgattgaagaggcttac
gctggttttaatcatgaatccattgcgcctatggtgcaggtggggaataacgaatgggtg
ttggagctattccgtggtccaaccttagcctttaaagactttgcattacagttgctaggc
cgcttgatggattatgtattggcaaagcgcaacgaaaagctggtcattatgggtgcaacc
tctggtgatacaggttcggcagccattgaaggttgtcgccattcagagcacttaagcatc
tttatcttgcacccatatcagcgagtatcagaagttcagcgtcgtcaaatgacgaccgtg
attgatgacaatgttttcaatgtggcggttaaagggaattttgatgattgtcaggggatg
gtgaaatccagttttgcagatcaatccttcttgaaaggcgctaaactcggtgctgtgaac
tccatcaactgggcgcgtattatggctcagatcgtttactacttctcttctgctttagcg
gttggtgggcctcatcgtaatgtctcgttttcggtcccaacaggtaactttggggacatt
tttgccggttatctggcgaagaaaatgggcctgccagtagatcaactagtggtcgccact
aaccaaaatgatattttgcaccgtgtgattgccgaaaacgacatgagtcgccaagccttg
aatgtaaccttgtcccctagtatggatatcatggtttctagtaatttcgagcgtttgttg
tttgatgctcatggacgtaatggggctgaaattgatgatctaatggcgcgttttaacaaa
ggtgatgtgtcattgaatgatcaagcatggtctttcgtgaaagagaattttgacagttat
aaagtggacgataagcgaacttgtgaggtgattactgaggtgcatgatagtgcgcaatac
ttgcttgatcctcatacagcaatcggacttgaagcggcgcgtcaatgttggaaagacaag
tctgttcctatgatcaccttggcaacagcgcatccggtgaaattcccagaagccgtggaa
aaagcaggttgtgacctaccaaacttgcctgagcacatgaaagatttgtttgaacgtgaa
gagtcttattcggtgttagacaatgaactgacacaagtgcagtcttttgttgctgagcgt
atttaa

DBGET integrated database retrieval system