KEGG   Marinomonas posidonica: Mar181_0627Help
Entry
Mar181_0627       CDS       T01508                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mpc  Marinomonas posidonica
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mar181_0627
   00670 One carbon pool by folate
    Mar181_0627
Enzymes [BR:mpc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mar181_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
678995..679504
Genome map
AA seq 169 aa AA seqDB search
MLSLIVAMSTNRTIGINNSLPWHLPNDLKYFKQATMGKPIVMGRKTFESIGKPLPGRRNI
VITRDANYQADGIDVVSSLEQAISLGEDICLVDGQEEVMVIGGAQIYELALPKADRLYIT
HVDAEVNGDAFFPEVDWPSFTVMAEESFAAEGPNPYDYRFSVYQRTSAE
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcacttattgttgctatgtctacgaaccgaaccataggtattaataattcgctg
ccttggcatttaccaaatgaccttaaatacttcaagcaagcgaccatgggcaagccaatt
gtgatgggacgtaagacctttgaatcgattggtaagccattgccgggccgtcgtaacatt
gtgattactcgtgatgcgaattatcaggcagatggcattgatgtggtgtcctcgttagag
caagctatttcacttggggaagacatttgcctggtggatggtcaagaggaagtcatggta
attggtggtgcgcagatttatgaattggcattgccgaaagccgatcgattatacatcact
catgtggacgccgaggtgaatggcgatgcttttttccctgaagtggattggccgtctttt
acggtcatggcggaagagtcttttgcagcagaaggaccgaacccgtacgattatcgtttc
tcagtgtatcaaagaaccagcgcagagtag

DBGET integrated database retrieval system