KEGG   Marinomonas posidonica: Mar181_0638Help
Entry
Mar181_0638       CDS       T01508                                 

Definition
(GenBank) Enoyl-CoA hydratase/isomerase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00071  Fatty acid degradation
mpc00280  Valine, leucine and isoleucine degradation
mpc00281  Geraniol degradation
mpc00310  Lysine degradation
mpc00360  Phenylalanine metabolism
mpc00362  Benzoate degradation
mpc00380  Tryptophan metabolism
mpc00410  beta-Alanine metabolism
mpc00627  Aminobenzoate degradation
mpc00640  Propanoate metabolism
mpc00650  Butanoate metabolism
mpc00903  Limonene and pinene degradation
mpc00930  Caprolactam degradation
mpc01100  Metabolic pathways
mpc01110  Biosynthesis of secondary metabolites
mpc01120  Microbial metabolism in diverse environments
mpc01130  Biosynthesis of antibiotics
mpc01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mar181_0638
   00650 Butanoate metabolism
    Mar181_0638
  Lipid metabolism
   00071 Fatty acid degradation
    Mar181_0638
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Mar181_0638
   00310 Lysine degradation
    Mar181_0638
   00360 Phenylalanine metabolism
    Mar181_0638
   00380 Tryptophan metabolism
    Mar181_0638
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mar181_0638
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Mar181_0638
   00281 Geraniol degradation
    Mar181_0638
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Mar181_0638
   00627 Aminobenzoate degradation
    Mar181_0638
   00930 Caprolactam degradation
    Mar181_0638
Enzymes [BR:mpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Mar181_0638
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-ProteinID: AEF53695
JGI: Mar181_0638
UniProt: F6D0X2
Position
692541..693425
Genome map
AA seq 294 aa AA seqDB search
MKTKTSVKSNPVDTEQKSEEFKDNIESITATDTQAKVAPMETILVERRERVGMITLHRPK
SLNALSRQLAREVVDTLKAFDADNNIGAIVITGSARAFAAGADIEEMANLNYSEFYCDDI
FAPWDELRSISKPIIAAVSGYALGGGCELALMCDFIIASEDAQFGQPEIKLGILPGIGGS
QRLTNAVGKSLAMDLVLTGRTIDVQEAKAAGLVARVVPAKELLQTALEAAHTIAGYNSPA
VRMAKEAVNVAFETSLTEGMRHERRLFQAAFATEGQKEGMHAFIAKRAPVFRHR
NT seq 885 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccaaaaccagtgttaaatctaaccctgttgatacagaacaaaaaagtgaagaa
ttcaaagataatatcgaatctattactgccactgacacacaagcaaaggtagcgccgatg
gaaaccatattggtagaacgccgtgaaagggtcggcatgattactctacataggccaaaa
agcctaaatgccttgagtagacagcttgcaagagaagtggttgatacgctgaaggccttc
gatgcagacaataatataggtgccattgttattacgggtagtgcccgagcatttgctgct
ggagcagatattgaggaaatggctaatttaaattactccgagttttattgtgacgatatt
tttgctccttgggacgaattacgttcaatcagcaaaccaatcattgctgctgtgagtggt
tatgcgctaggcggtggctgtgagctagccttgatgtgtgattttatcattgcttctgaa
gatgcccaatttgggcaaccagaaattaaacttggtattttgccgggcatcggtggatcg
caacgtttgaccaatgctgtaggtaaatcgctagcgatggatcttgttttaactggacga
acaattgatgttcaggaagcaaaagcggctggattagtcgcgcgagtcgtgcctgctaaa
gagttgttacaaactgcgttggaagcagcacatactattgctggatataacagccctgcc
gtacgaatggccaaagaagcagtaaacgtagcctttgagaccagtcttactgaagggatg
cgtcatgagcgtcgtttgttccaggcggcctttgcgacagaggggcaaaaagaaggcatg
catgcgttcattgctaagcgagcccctgtttttcgtcaccgttag

DBGET integrated database retrieval system