KEGG   Marinomonas posidonica: Mar181_0729Help
Entry
Mar181_0729       CDS       T01508                                 

Definition
malonyl-CoA decarboxylase (EC:4.1.1.9)
Orthology
K01578  
malonyl-CoA decarboxylase [EC:4.1.1.9]
Organism
mpc  Marinomonas posidonica
Pathway
beta-Alanine metabolism
Propanoate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Mar181_0729
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Mar181_0729
Enzymes [BR:mpc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.9  malonyl-CoA decarboxylase
     Mar181_0729
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
809554..810819
Genome map
AA seq 421 aa AA seqDB search
MSMMMELLSHIFDRRYRPLAKNKTESDSSIIVLADNLIGTAGESSGLTLATQILDRFETL
EDEDKLSFFNHLSSNMDINPVDVEGALADYKEQPSKKTYLRYMESVEPRRQELIRRLNQV
AGATGKLVNMRADLLRLKGKSDALAALDLDFRHLFVSWFNRGFLVLRPINWETPAHILEK
IIAYEAVHAIDSWDDLRRRMQPEDRCCFAFFHLSMPDEPLIFVEVALTHGIANSVQSVLS
EDREEILISEADTAVFYSISNCQRGLNSISFGNSLIKQVVTDLSSRFSNLKNFVTLSPIP
SLMTWAQQQSIDTTSEPFNDMKSLAAHYLLNEKGQSGKPLDPVARFHLGNGAKIHAIHND
ADLSDKGIRQSGGAMVNYLYELKNVSENHEKFAATGYISAIQDIHKLCENLSPLLREKNN
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagcatgatgatggagttgttaagccatatttttgatcgacgttatcgacctctcgca
aaaaataagacagagagtgatagctctattattgttttggcggataatttaatcggcacg
gcaggtgaatcgtcaggactcacactggccacgcaaattcttgatcgctttgagacgcta
gaagatgaagataaactctccttttttaatcatttatctagcaacatggatattaaccct
gttgatgttgaaggcgcgcttgcggattacaaagagcagccatctaaaaaaacctacctt
cgttatatggagtccgttgagcctagacgacaagagttgattcggcgtctaaatcaagtt
gcaggggcgacggggaagttagtaaatatgcgagccgacttactaagattgaaggggaaa
tccgatgcgcttgccgcattagacttggatttccgtcatttgtttgtttcatggttcaat
cgtggctttttggtattgcgtccgattaattgggaaacccccgctcatatactagaaaag
atcattgcttatgaggcggttcacgccatagacagttgggatgatttgcgtcggcgtatg
cagccagaagatcgttgctgctttgctttttttcatttatctatgcctgatgaaccgttg
attttcgtggaagttgctttaacacatggcattgcaaattctgttcaatccgttttatct
gaagatcgtgaagagatattgattagtgaagcagatacggcggttttctattctatttct
aattgtcagcgaggactgaatagtatttcgtttggtaactctctaattaaacaggtagtg
actgacctgtcttcaagatttagtaacctgaaaaactttgtcaccttatcgcctatccct
agtttgatgacatgggctcagcaacagagcattgatacaacatctgaaccctttaatgac
atgaagtcgttggcagcccattatttgcttaatgagaaaggacaaagtggcaagcctctc
gaccctgttgcacgtttccatttgggtaatggggccaaaatacatgccattcataacgat
gctgatttatctgataaaggtatcaggcaatcaggaggagccatggtgaactacctttat
gaattgaaaaatgtgtcagaaaaccatgagaaatttgccgcaacgggatacatctcggcg
attcaagatattcataaactatgcgagaacttgtctccactgttaagagaaaaaaacaat
gtctaa

DBGET integrated database retrieval system