KEGG   Marinomonas posidonica: Mar181_0737Help
Entry
Mar181_0737       CDS       T01508                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mpc  Marinomonas posidonica
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mpc00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mpc00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mpc00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:mpc00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(819635..820471)
Genome map
AA seq 278 aa AA seqDB search
MIRKCLFPVAGYGTRFLPATKSMPKEMLPIVNKPLVQYGVEEATAAGLNNVTFVTGRGKR
AIADHFDISYELEHQISGSSKEKYLEGIRHLIDHVNFSFTRQNNMLGLGHAILTGEPLIG
DEAFGVVLADDLCFGEDDGVMAQMVKLYNQFRCTIVAIEEVPEDEVHKYGVIKGESMMEG
LFRVTDMVEKPSKEDAPSNLAIIGRYILTPDIFDKIRNTPPGRNGEVQITDAIMQQAKEG
CVLAYKFKGKRFDCGSVDGFVDATNFCYKNIYKDPTES
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatacgcaaatgtctattccctgttgcaggctacggcacccgttttttgccagccact
aagtccatgcccaaagaaatgcttccaatcgttaacaaaccacttgtgcaatatggtgtc
gaagaggcaacagccgcaggtcttaacaatgttacttttgtaacaggacgaggcaaacga
gccattgcagatcactttgatattagctacgaactggaacaccagatctcaggctccagt
aaagaaaaatatcttgaaggcattcgtcaccttatcgaccatgtaaacttttcttttact
cgtcaaaacaacatgttaggtctaggtcatgccattttgaccggcgaacctttaatcggt
gacgaagcctttggcgtcgtcttagcggacgacctttgtttcggtgaagacgacggtgtc
atggcgcaaatggtaaaactctacaaccaatttcgttgtactattgtggccattgaagaa
gtacctgaagacgaagtacataagtatggcgtgattaaaggtgaatccatgatggaagga
cttttccgagtgactgacatggttgagaaaccatccaaagaagacgcgccatccaacctt
gctattattggtcgctatattcttacgccagatatctttgacaaaattcgcaatacaccg
cctggtcgaaatggtgaagtacaaattacagatgccatcatgcagcaagcaaaagaaggg
tgtgttttggcttataaattcaaaggtaagcgctttgattgtggtagtgtcgatggtttt
gttgacgcgacgaatttctgctacaaaaacatctataaagatccaactgaatcttaa

DBGET integrated database retrieval system