KEGG   Marinomonas posidonica: Mar181_0872Help
Entry
Mar181_0872       CDS       T01508                                 

Definition
magnesium chelatase (EC:6.6.1.1)
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mpc  Marinomonas posidonica
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:mpc00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
956676..958430
Genome map
AA seq 584 aa AA seqDB search
MIPNTTPDFPFTAIAGQELLKLALTLNAVNPLIGGVLISGPRGSAKSTLARGLAGVMPAL
LSDAPVPFATLPLGTSEDRLLGALDLEQVLQDKQVAFKPGLLSQAHGGVLYVDEVNLLAD
HLVDQLLDVAASGINRIERDGVSHQHESKFLLVGTMNPDEGELRPQLKDRFGFMVTLTNQ
YSLEERVQIVRLRDEFDLDPSAFCDAFKYKQRNLKNSIRLARQKLTQVRCSDAMRMAIAE
HCQQANIDGVRGDIVWVRAAMAHAAWRGDEQVSLEDVTVVAELVLAHRRHLSSPNPPASQ
PPGAQPPEPSRRPDSSKSPAELDAEQSASPQEGDWGAMTPESMRSESSIQLNLAGQLSSP
VDAPKKSLREVTPGKHKGQQQGGYRLDASVSGEGIDWFRSLLSQPQQWPPQELKSKAAQT
GQPMLHLILLDTSASTLEQAMFAKAKGVILDIAQQAYIAREQIAILGFGQQGVSSILPKV
RAPKDILAVLDDIPAGGGTPFRQVLEKAQAYLQQQHQLTSGLRSQTYLLTDGRTQANVSD
LILAGDVALIDTESSAIKRGRGKVIAQAINAQYVPLNTLFETSL
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgataccaaataccacacctgactttccttttaccgccattgcggggcaggaattgctt
aagcttgcactgaccttaaacgccgttaatcctttgattggtggtgtgttaattagcggt
cctcgtggttcggcgaagtccactttagcgcgaggtttagctggggttatgccagccttg
ttaagtgacgctccggtgccatttgcgaccttgccgcttggcaccagtgaagaccgtttg
ttgggtgcattggatttggagcaagtattgcaagataagcaggtagcctttaaacctggt
ttattaagtcaggcccatggtggtgtgttgtatgtggatgaagtcaatttgctggccgat
cacttggtggatcaattgttggatgtggcagccagtggcatcaatcgaatagagcgtgat
ggcgttagccatcaacatgagtcgaaatttcttcttgtgggaaccatgaaccctgacgaa
ggtgagctccggccacagctaaaggatcgatttggctttatggtcactttgacgaatcag
tatagtttagaagagcgcgtgcaaattgtgcgcttgcgagatgaatttgacttagatccc
agtgctttttgtgatgcctttaagtacaaacagcgcaaccttaaaaacagcattcgttta
gcgcggcaaaaactcacccaggtacgttgttcggatgctatgcgcatggccattgctgag
cattgtcagcaggccaatatagatggtgtacgaggggatattgtttgggtcagagccgct
atggctcatgccgcatggcgtggcgatgagcaagtctcattggaagatgtgactgtggtg
gctgagttagtactggcgcatcgccgtcatctatcttccccgaatccaccggcttcccaa
ccgccaggggctcaacctcctgaaccatcgagacgtcctgattcatcgaaatcaccagca
gagttagacgctgagcagtctgcttcaccacaagagggggattggggagcgatgacaccc
gagtcaatgcgcagtgaatcatcgattcaattgaatctagctggccaactttcgtctccc
gttgatgcacctaaaaaaagtctgagagaggtgacgccgggaaagcataaaggtcagcaa
cagggcggttatcgccttgatgcgagtgtcagtggtgaaggtattgattggtttcgcagt
ctccttagtcagccacagcaatggccgccacaagagttaaaatcgaaagcggcgcagact
ggacaacccatgttgcatttaattttattggatacgtctgcctcgacgttagagcaagct
atgttcgcaaaagccaaaggcgtcattttagacatcgcacaacaggcgtatatagccaga
gaacaaatagcgattctaggctttggacaacagggggtgtcgtctatcttgccaaaagtc
cgagcgccaaaagacattttagccgtgttggatgatattcctgcgggtggcggtacacca
tttcgacaagtgttggaaaaggcgcaagcctatttacaacaacagcatcaattaacctct
ggcctgcgcagtcagacgtatttattaaccgatggccgtactcaggccaatgtgtcagat
ttaatattggctggcgatgtggctttgattgatacagaaagctcggccatcaagcgtggt
cgaggcaaagtcattgcccaagcgataaacgcgcagtatgtgcctttgaataccctgttt
gagacttctttatga

DBGET integrated database retrieval system