KEGG   Marinomonas posidonica: Mar181_0907Help
Entry
Mar181_0907       CDS       T01508                                 

Definition
cytochrome-c peroxidase (EC:1.11.1.5)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mpc  Marinomonas posidonica
Brite
Enzymes [BR:mpc01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Mar181_0907
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
992877..993980
Genome map
AA seq 367 aa AA seqDB search
MYTRLLLYMVSFCSLLIASFCGAELVLDKDKWQWHLPPDVTPPVVPKNNPMSNAKVELGR
RLFFDLNLSGAGYVSCATCHLPEKSYAENRPVSVGITGEFHSRNAMSLVNTAYMTTLTWA
DPNIRLFEDQAKIPVFGTHPIEMGTKGYENKVLSYLSEHPLYPSQFETAFPNRNAIDFEQ
VFMAIGAFERTLISVNSPYDRYRFYGQEDAISVNAKKGEALFFSEKLACSGCHSGRHFSD
ATLQPNFHNTGLYNVDMKGSYPQGNEGLYEVTKRDLDKGKFRTPTLRNIELSAPYMHDGS
LNSLEEVVKHYAAGGQSAIHGEPSPLRDSKIKGFELSQAEVLYLIEFLKSLTDESYIEDQ
LNHAPFQ
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaaggttattattgtatatggtctcattttgttctcttcttattgcgtcattt
tgtggtgcagagttggtgttggataaggacaaatggcaatggcatcttccaccagatgtt
acgcccccagtggtgcctaagaataacccaatgagtaacgcaaaagtcgaactgggtcgg
cgacttttctttgatttgaatctatccggagcgggttatgtttcctgtgcaacctgccat
ttacccgaaaaatcctatgcggaaaatagacctgtttccgttggcattacaggggagttt
cattctcgcaacgccatgtctcttgttaataccgcctatatgacaaccttgacttgggca
gacccgaatataaggttatttgaagatcaggcgaaaatcccagtgtttggtactcatcct
atcgaaatgggaaccaagggctatgaaaacaaagtattgagttacctttctgagcatcct
ctttatccatctcaatttgaaacggctttcccaaatcgtaatgcgatcgattttgagcaa
gtttttatggccattggtgcatttgagcgcaccttaatcagcgtgaattctccttatgat
cgataccgtttttatggtcaagaagacgccatcagtgttaatgctaaaaagggcgaggct
ttattctttagtgaaaaattagcctgttcgggttgccactctggacgccattttagtgat
gccactttgcagccaaatttccataatactgggctttataatgtggatatgaaaggcagc
taccctcaggggaatgaaggactttatgaagtcactaagcgtgatttagacaaagggaaa
tttcggacaccgacgttacgaaacatcgaactgtctgctccctatatgcatgatggttcg
ctaaacagccttgaggaggttgttaagcactatgccgctggtggacaatctgcgattcat
ggtgaaccgtcaccacttcgcgactcgaaaattaaaggttttgagctatcccaagcagaa
gtgctttatttgattgaatttttaaaaagtctaacagacgaatcgtatattgaagatcaa
ttaaatcatgctccctttcagtaa

DBGET integrated database retrieval system