KEGG   Marinomonas posidonica: Mar181_0947Help
Entry
Mar181_0947       CDS       T01508                                 

Definition
dihydrofolate reductase (EC:1.5.1.3)
Orthology
K13938  
dihydromonapterin reductase / dihydrofolate reductase [EC:1.5.1.- 1.5.1.3]
Organism
mpc  Marinomonas posidonica
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Mar181_0947
   00670 One carbon pool by folate
    Mar181_0947
Enzymes [BR:mpc01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     Mar181_0947
    1.5.1.-  
     Mar181_0947
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1034075..1034797
Genome map
AA seq 240 aa AA seqDB search
MMRKSPIIITGGGQRLGLACAQALHEQGYKVIITYRRHREEINAIEASGIQCLQADFSTQ
NGVEAFIKKVLEDYDALGAIIHNASEWEAEKNCSDTKLLMEKMWQVHVFAPYRINLAFEG
LLCAGFKDDGVADIIHMTDYVVEKGSDKHIAYAASKAGLANLTCSFAKRYSPCIKVNAIA
PSLLMFHNSDNDDYRQKALNKSLLQKEPGEQEGVLAVKYVLESGYLTGRTLSLDGGRHLV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgaaaatcccccatcattattacaggaggtggccagcgactggggttagcctgt
gctcaagcgctacatgagcaaggttataaggtgatcatcacgtatcgccgacaccgtgaa
gagattaacgccatagaagcgtctgggattcaatgccttcaggccgacttttcaacgcag
aatggtgttgaggccttcattaaaaaagtgttggaggattatgatgctctgggcgcaatt
attcacaatgcctctgaatgggaagcggagaaaaattgctcagatacgaagttattgatg
gaaaaaatgtggcaagtacacgtatttgcaccttatcgtataaatctggccttcgaagga
ttattatgtgcaggttttaaagacgatggggtcgccgacattattcatatgacggattat
gtcgttgaaaagggcagtgacaaacacatagcttatgccgctagcaaagctggtttagcg
aatttaacttgctcttttgctaaacgttactcaccttgtattaaggtgaatgcaattgcc
ccatcattattgatgtttcataacagtgataacgacgactaccgacagaaagcgttaaat
aagtcactgttacaaaaggagccgggagagcaggaaggcgtactcgcagttaagtatgtg
ttggaaagcggctacttgacaggtcggaccttgtctctggatggaggcagacatttggtg
tag

DBGET integrated database retrieval system