KEGG   Marinomonas posidonica: Mar181_1055Help
Entry
Mar181_1055       CDS       T01508                                 

Definition
(GenBank) acetate/CoA ligase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00010  Glycolysis / Gluconeogenesis
mpc00620  Pyruvate metabolism
mpc00640  Propanoate metabolism
mpc00680  Methane metabolism
mpc01100  Metabolic pathways
mpc01110  Biosynthesis of secondary metabolites
mpc01120  Microbial metabolism in diverse environments
mpc01130  Biosynthesis of antibiotics
mpc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mar181_1055
   00620 Pyruvate metabolism
    Mar181_1055
   00640 Propanoate metabolism
    Mar181_1055
  Energy metabolism
   00680 Methane metabolism
    Mar181_1055
Enzymes [BR:mpc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Mar181_1055
Lipid biosynthesis proteins [BR:mpc01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Mar181_1055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEF54104
JGI: Mar181_1055
UniProt: F6CU52
Position
1152070..1154028
Genome map
AA seq 652 aa AA seqDB search
MKSLYSAISIEAEKQANISQAEFGKRYQESIENPDAFWGREGLCLDWSKPYTKVKNTSFE
RGNISIKWFEDGELNVAHNCIDRHLPQLADKVAYYCEGDLENDEKVAITYQTLHDEVGRL
ANVLKRQGVKKGDRVAIYMPMIPQAVYSMLACARIGAIHSVIFGGFSAHAIADRLNDCGV
KLVITADEGKRAGNTIPLKHNVDMALDNNACPLVEKVLVCRYTQKDIPWVAGRDLDWAQE
TANEPTFCPAEPMNAEDPLFILYTSGSTGKPKGVVHTTGGYLVYVSITHGLVFDLKADDV
YWCAADVGWITGHSYMVYGPLANGATSLLFEGVPTFPDSGRIGRVVDKFGVTILYTAPTA
IRALMAKGDEATQSSERKSLRILGSVGEPINPEAWSWYFSEIGNSACPIVDTWWQTETGG
MMMTPRIGQGDIKPGFCTGPLYGIKPALVDAQGVVVEDQGALAEGGLVITDSWPGQARTV
YGDHDRFEQTYFSTFGGMYFTGDGASRDEDGHYLITGRMDDVLNVSGHRLGTAEIESALV
AHPSVAEAAIVGYPHDIKGQGIYVYVTPVAGVTPDEELSKSLKQFVRQEIGPIATPDLIQ
WASRGLPKTRSGKIMRRILRKIAANEQDQLGDTSTLADPSVVDDLIENRLNE
NT seq 1959 nt NT seq  +upstreamnt  +downstreamnt
atgaaatcattatatagcgcaatttcaattgaagcggaaaagcaggccaatatcagtcag
gccgagtttggaaaacgctatcaagaatcgattgaaaacccagatgcattttggggcaga
gaaggcttgtgcttagactggtctaagccatataccaaggtaaaaaatacctcatttgag
cgaggtaacatcagcataaaatggttcgaagatggtgagttaaacgtggctcataactgc
atcgatcgtcaccttcctcaactggctgataaagtggcttattactgtgaaggggattta
gaaaacgatgaaaaagttgcgattacctatcaaactttacacgatgaagtaggccgattg
gcaaatgtgctaaagcgccaaggggttaaaaaaggggatcgtgttgccatttatatgccg
atgattccccaagccgtatacagtatgttggcttgtgctcgcattggtgctattcactcc
gttatttttggtggtttttctgcccatgctattgccgatcgtttaaacgattgtggtgtg
aaattggtgattaccgccgatgaaggtaagcgcgctggtaacactattccattaaaacat
aacgtcgatatggcgttagacaataatgcttgtcctttggtagaaaaagtcctggtatgt
cgttacacacagaaagacattccatgggtcgcaggtcgtgatttggattgggcacaagaa
acggccaacgaaccgaccttctgtcctgctgaacctatgaacgcggaagacccattgttc
attctttatacctcaggctcaacaggtaaaccaaaaggggtcgttcacacaactgggggg
tatttggtctatgtctcgattactcacggccttgtgtttgatttaaaagcggatgatgtt
tattggtgtgcagcggatgtcggctggattacgggccatagctatatggtatacgggcca
ttggcgaatggggcaaccagtcttctatttgaaggggtgccaactttcccagactctggc
cgtattggccgtgtagttgacaagtttggtgtcactatcttgtacacggcaccaacggcc
atccgagctttgatggccaaaggagatgaggcaactcaatccagtgagcgcaaatcttta
cgaattttgggcagtgtgggtgaaccgattaacccagaagcttggtcttggtattttagc
gaaatcggcaatagtgcttgtccaatcgtcgacacctggtggcaaaccgaaacgggcggc
atgatgatgacccctagaattggtcaaggggacattaaaccgggtttctgtactggtcct
ttgtatggcataaaacctgctttggttgatgctcaaggtgtggtggtcgaggatcagggg
gcgttagccgaaggggggttagtcataacggactcttggcctgggcaagcgcggaccgtt
tatggtgatcatgatcgttttgaacaaacctatttcagtacctttggtggtatgtatttt
acgggagatggagcgtctcgtgatgaagacggacattatttaattacaggccgaatggat
gacgtgttaaatgtgtctggtcaccgtttgggcacagctgaaattgaaagtgctctggtt
gcccatccatcggtagcggaagcggcgattgtagggtatccacatgacatcaaagggcaa
ggtatttatgtttatgtgacgccagtggcgggggtgacgcccgacgaagaattgagtaaa
tctttgaaacagtttgtgcgccaagaaattggcccaattgcgacaccggatttgattcag
tgggcgagccgaggccttcctaaaacccgttcaggtaagattatgcgtcgtattttgcgc
aaaattgcggcaaatgaacaagatcaattaggtgataccagtacgctggcagatcctagc
gtggttgatgatttgattgaaaaccgtttaaatgagtag

DBGET integrated database retrieval system