KEGG   Marinomonas posidonica: Mar181_1265Help
Entry
Mar181_1265       CDS       T01508                                 

Definition
(GenBank) succinate dehydrogenase, hydrophobic membrane anchor protein
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
mpc  Marinomonas posidonica
Pathway
mpc00020  Citrate cycle (TCA cycle)
mpc00190  Oxidative phosphorylation
mpc00650  Butanoate metabolism
mpc01100  Metabolic pathways
mpc01110  Biosynthesis of secondary metabolites
mpc01120  Microbial metabolism in diverse environments
mpc01130  Biosynthesis of antibiotics
mpc01200  Carbon metabolism
Module
mpc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mpc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
mpc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mar181_1265
   00650 Butanoate metabolism
    Mar181_1265
  Energy metabolism
   00190 Oxidative phosphorylation
    Mar181_1265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt
Motif
Other DBs
NCBI-ProteinID: AEF54312
JGI: Mar181_1265
UniProt: F6CW13
Position
1364145..1364492
Genome map
AA seq 115 aa AA seqDB search
MVTQITSFGRSGLYDWMMQRVSALVLSVYTLFMIGYLVSNPDLTYEQWSALFETTWMRIF
SLLVLLSIGIHSWIGLWSVSTDYIKATGARFFFQSLCGLAMFVYIVWGIQVLWGL
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaactcaaattacaagctttggtcgttctggcctatatgactggatgatgcagcga
gtctctgcattggttctatcagtctatactttgtttatgatcggttatttggtgagtaat
ccagatctgacttatgagcaatggagcgcattgtttgaaacaacttggatgcgcattttt
agtttgttggtcttgttgtctatcggtatccactcttggatcggtttgtggtctgtttcg
acagactatattaaagcaacaggtgcacgttttttctttcaatctctatgcggtttggcc
atgtttgtgtacatcgtgtggggcattcaggttctttgggggctataa

DBGET integrated database retrieval system