KEGG   Marinomonas posidonica: Mar181_1269Help
Entry
Mar181_1269       CDS       T01508                                 

Definition
2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase (EC:2.3.1.61)
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mpc  Marinomonas posidonica
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mar181_1269
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mar181_1269
  Amino acid metabolism
   00310 Lysine degradation
    Mar181_1269
Enzymes [BR:mpc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Mar181_1269
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1370227..1371735
Genome map
AA seq 502 aa AA seqDB search
MSIEIKAPTFPESVADGTVATWYKKPGEACARDEHIVDIETDKVVLEVVAPADGVIAEVL
KNEGDIVLSDEVLAKFEEGGAAASAPAAEKAADAPAASTSAKETVQIKAPTFPESVADGT
VAAWHKQPGEACSRDEHIVDIETDKVVLEVVAPADGVIGEITKNEGDTVLSDEVLASFLV
GASGGAAPAPVEAATAAPAAEGDEDGVAGPAARKALAEAGLSAAQVKGTGKGGRITKEDV
DAAVKAKPAAAPVAKAAPAAAMPALGADGRVEKRVPMTRLRATIAKRLVEAQQTAAMLTT
YNEVNMGPVMEIRKKYKDEFMKVHNGTKLGFMSFFVKAATEALKRFPAVNASIDGNDMVY
HGYQDIGVAVSTDRGLMVPVLRNTEAMGLANIESTIMDFAIRGRDGKLGMDDMQGGTFTI
TNGGTFGSLMSTPIINPPQTAILGMHKIQERPMAVNGQVVIQPMMYLALSYDHRMIDGKE
AVQFLVTIKELLEDPARLLLEI
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgagcattgaaattaaagcacctacttttccagaatctgtagccgacggaactgttgct
acttggtacaaaaagccaggtgaagcctgtgcccgtgatgagcacattgtcgacattgag
acggataaagtggttctagaagtggttgcgccagctgatggtgtcatcgccgaagtattg
aaaaatgaaggtgacatcgtattgagcgatgaagtcttagcaaaatttgaagagggcggt
gcagcggcatccgctccggcagctgaaaaagcagccgatgcgccagccgcatcaacttct
gcaaaagaaacggtacaaatcaaagcaccaactttccctgaatccgttgctgacggtacc
gtagcggcttggcacaagcagccaggcgaagcttgttctcgtgatgagcacatcgttgac
atcgaaacggataaagttgttttggaagtggttgccccagcagatggtgtgatcggtgag
attactaagaacgaaggcgatactgtcctaagtgatgaagtattggctagttttctagtg
ggtgcctctggtggcgcagctcctgctcctgtagaagcggcgactgcagcgccagccgct
gaaggcgacgaagatggtgtagcaggtcctgcggcacgcaaagccttagcagaagctggt
ttatcagcggcacaagttaaaggtacgggtaaaggcggacgcatcactaaagaagatgtt
gatgcagctgtgaaagcgaagccagcggcggcaccagttgctaaagcggcaccagctgca
gcgatgccagcattgggtgcggatggtcgtgttgaaaaacgcgtacctatgacgcgtcta
cgtgcgacaatcgctaaacgtttggttgaagctcaacaaacagcagcgatgttaacaacg
tacaacgaagttaacatgggtcctgttatggaaattcgtaagaaatacaaagacgaattt
atgaaagttcataatggtactaaactgggcttcatgtctttctttgtgaaagcggcaaca
gaggctctaaaacgcttccctgcggtgaatgcatctattgatggtaatgacatggtttac
catggttaccaagatatcggtgttgctgtctcaacggatcgtggcttgatggttcctgta
cttcgcaatactgaggcgatgggtcttgcgaacatcgaatcgactatcatggattttgca
atccgtggtcgcgacggtaagttgggtatggacgatatgcaaggtggtacgttcaccatt
actaatggcggtacgtttggctctttgatgtctacgccaatcattaacccaccacaaacg
gctatcttgggtatgcataaaatccaagagcgtccaatggcggtaaatggtcaagtggta
attcagccaatgatgtatctggctctgtcttatgaccaccgtatgatcgatggtaaagaa
gccgttcaattcttggtaaccattaaagaattgctagaagaccctgcgcgtcttttactt
gaaatctaa

DBGET integrated database retrieval system