KEGG   Marinomonas posidonica: Mar181_1271Help
Entry
Mar181_1271       CDS       T01508                                 

Definition
(RefSeq) succinyl-CoA ligase (ADP-forming) subunit beta (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mpc  Marinomonas posidonica
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Mar181_1271
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Mar181_1271
   00640 Propanoate metabolism
    Mar181_1271
   00660 C5-Branched dibasic acid metabolism
    Mar181_1271
Enzymes [BR:mpc01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Mar181_1271
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1373355..1374521
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQAKQLFAEYGLPVSTGYAVDTPEEAVEAAKKIGGDKWVVKAQVHAGGRGKAGGV
KLVDSYDEVKAFAANWLGKNLVTYQTDANGQPVAKILVESCTDIANELYLGAVVDRSTRK
VVFMASTEGGVEIEKVAEETPELIHKAIIDPLVGAQPYQAREMAFKMGLNPTQIKQFTKI
FLGLSQMFHDCDFALLEINPLVITDEGNLHCLDGKINIDSNAVYRQKKMQEFHDPSQEDE
REAHAAQWELNYVALDGNVGCMVNGAGLAMGTMDIVNLHGGKPANFLDVGGGATKERVAE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVEQVGVNVPVVVRLEGTNAEKGREV
LANSGLDIIAASSLKDAAEQVVKAAEGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaacctacatgaatatcaggctaaacagctttttgctgaatacggcctgccagtatcg
acagggtacgcagtagacacgccagaagaggcggtcgaagctgcgaaaaaaattggtggt
gacaagtgggttgttaaagctcaagtacacgcaggtggccgtggtaaagcgggcggtgtg
aagcttgttgattcttatgacgaagtgaaagcctttgcggcaaattggttaggtaaaaac
ctagttacttaccaaacagacgcaaatggtcagcctgttgctaagattcttgttgaatct
tgcactgacatcgccaacgaattgtacctaggtgctgttgttgaccgttctactcgtaaa
gtcgttttcatggcctctactgaaggtggtgttgagatcgagaaagtagcggaagaaacg
cctgagttgattcacaaagcgatcattgatccgctagttggcgctcagccataccaagct
cgtgaaatggcatttaaaatgggtcttaacccaactcaaatcaagcagttcactaagatc
ttccttggtttgtcacaaatgttccatgactgcgatttcgcactacttgaaatcaaccct
cttgttattacagatgaaggtaaccttcactgtctagacggtaagatcaacatcgacagc
aacgctgtttaccgtcagaagaaaatgcaagagttccacgatccatctcaagaagatgag
cgtgaagcgcatgccgcacaatgggaacttaactatgttgcactagatggtaacgtaggt
tgcatggtaaacggtgccggcctagcaatgggtacaatggacatcgttaacctacacggc
ggcaagccagctaacttcctagacgtaggtggtggtgcaacaaaagaacgtgttgctgaa
gcattcaaaatcatcctttctgacagcaatgttaaagccgtattggttaacatcttcggt
ggtatcgttcgttgcgacatgatcgcagaaggtatcattggtgcggttgagcaagttggt
gtaaacgtacctgttgttgtacgtttggaaggtactaacgcagagaaaggccgtgaagtt
ctagctaactctggtctagacatcattgctgcatccagtcttaaagacgcagcggaacaa
gttgttaaagctgcggagggcaaataa

DBGET integrated database retrieval system