KEGG   Marinomonas posidonica: Mar181_1288Help
Entry
Mar181_1288       CDS       T01508                                 

Definition
cyanate hydratase (EC:4.2.1.104)
Orthology
K01725  
cyanate lyase [EC:4.2.1.104]
Organism
mpc  Marinomonas posidonica
Pathway
Nitrogen metabolism
Class
Metabolism; Energy metabolism; Nitrogen metabolism [PATH:mpc00910]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1387384..1387824)
Genome map
AA seq 146 aa AA seqDB search
MKKIDVTEAIFASKHAQGLTWEAIADAVGMSDVWTTSACLGMNSCPEDVAEKLVSFLNLP
EGAKSVLMEYPTKTWQETIPQDPLIYRLYEIVGVYGPTLKEVIQEKFGDGIMSAIDFSMK
VEKEENPKGDRVILTLNGKFLPYASW
NT seq 441 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaattgatgtcacagaagcgattttcgctagcaaacacgcccaaggcttaacc
tgggaagccattgccgatgcggtcggcatgagcgatgtctggaccacatccgcttgttta
ggcatgaacagttgcccagaagacgtcgccgagaagttggtgagttttttgaatctacct
gaaggcgctaaatcggtattaatggaatacccgacgaaaacttggcaagaaaccattccc
caagacccccttatttaccgtctttacgaaattgtcggcgtgtatggcccgacattaaaa
gaagtcattcaggaaaaatttggcgatggcattatgagcgcgattgatttctcgatgaaa
gtcgaaaaagaagaaaatccgaaaggggatcgtgtgattctgacattaaacggaaaattc
ttaccttatgcgtcttggtga

DBGET integrated database retrieval system