KEGG   Marinomonas posidonica: Mar181_1372Help
Entry
Mar181_1372       CDS       T01508                                 

Definition
aldose-1-epimerase (EC:5.1.3.3)
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
mpc  Marinomonas posidonica
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:mpc00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:mpc00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1476875..1477852)
Genome map
AA seq 325 aa AA seqDB search
MPLTDLSQVKTVRLNNGQITVDVLTLGASLQAIYLKDYQHSMVLGSNQLADYLGPCRYFG
AIVGRVANRIANSQAQIGEQLYQLTPSSPSPHQLHGGPNGTDCKNWKIIKQSHDAVTLQV
MLQDGEMGFPGKLIINVIYQLLEQGLEMKIQASSDRLTLCNLAGHSYFNLDGHGSILDHK
LCVHAEHYLPADKDLIPTGEVSPTAGSQFDFTHLRTIGRDDYTELDTNFCLSLAPRSIQK
VATLKAPLTGIELELQTTEPGLQVYDGRHIALPKSNSINQVELAPYAGLALEAQHWPDAV
HHSHFPPILLTEGDTYEQTTRYLFS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgccactcactgacttatcacaagtgaaaacagttcgtctcaataacggccagatcaca
gtcgatgtattgactcttggtgccagtctccaagccatctatttaaaagattaccaacac
tctatggtgctcggctctaaccagctggcggattacttaggcccatgtcgatattttggt
gccatagtaggaagagtcgcaaaccgaattgccaacagtcaggcgcaaattggggagcag
ctttatcaactcaccccctcctcacccagcccacaccagttacacggtggcccaaatggt
acagactgcaaaaactggaaaattattaaacagtcccatgacgccgtcacacttcaagtc
atgctacaagatggtgagatgggctttcctggcaagcttatcattaacgtaatttaccaa
ttgctggaacaaggtttggaaatgaagattcaagcctcaagtgatcggctcaccctatgc
aatctggcaggccacagctacttcaacttagatggccatggctccattctagaccacaaa
ctctgcgtccatgctgagcattatttaccagccgataaagatttaattccaactggtgaa
gtaagccccactgcaggtagccaattcgatttcacccacttacgtaccataggtcgtgac
gattatacggaattggacaccaatttctgcttgtctttagccccaaggtccatccaaaaa
gtggcaacactgaaagcccccttgacgggcatagaactcgaacttcaaaccaccgaaccg
ggtttacaggtttacgatggccgtcatatcgccttacctaagagcaacagcattaaccag
gttgaattagcgccctatgctggtttggcacttgaagctcaacattggccagatgccgtt
catcattcccactttccccctatcctactaacggaaggtgacacctacgaacagactaca
cgctacctatttagctaa

DBGET integrated database retrieval system