KEGG   Marinomonas posidonica: Mar181_1451Help
Entry
Mar181_1451       CDS       T01508                                 

Definition
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
mpc  Marinomonas posidonica
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Mar181_1451
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Mar181_1451
Enzymes [BR:mpc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Mar181_1451
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1559986..1561452
Genome map
AA seq 488 aa AA seqDB search
MPVISHQELLNLAGYSEKNSPRSALYTHLEIDSRKLDANGVFFALAGVGSNGWDYLDDVV
ALGCQIAVVPTGVELERYDIELIAVDDPAALLVMCLHQYFGRMPSKMMAVTGTNGKSSIC
FYAAQLAEMMGYKSGLVGTFGIGPLEQLQTADQTTPDILTMHQTLMSLTQQGIDYVAFEA
SSHALDQGRIHGVPFQTAVFSNLTRDHLDYHGDMASYAAAKQKLFAFPSVQEAVYCLDDE
YVGFMTQPAINAHCIYYSEANSQADFYTKQLTLEPTGCRFVLCHPEGETDVFLPLLGRFN
VQNALAALACLWSAAKNKAALIACLSELKGAPGRMDKVEVLAAPLVVVDFAHTSDALESA
LNAIREHINGRLICVFGCGGDRDRGKRPLMMSAALDNADSVWLTSDNPRTESVEQIFSDV
LAKTDSQACYHLQADRRLAIHEAIMSANPDDVILVAGKGHEAYQDIDGVKYHFDDKEEAY
KVLEHYVS
NT seq 1467 nt NT seq  +upstreamnt  +downstreamnt
atgccagttatatcccatcaagaattactaaatttggcgggctattctgaaaagaatagc
ccgcgttctgctttatatacccacttagaaatagacagtcgaaaactggatgcgaatggg
gttttctttgcgcttgctggtgtcggttccaacggttgggattacttagatgatgtggtt
gccctaggttgtcaaattgccgtcgtaccgactggagttgagcttgaacgttatgacata
gagcttattgccgtcgatgatccggccgctttattagtgatgtgtttgcatcaatatttt
ggccgcatgccaagcaagatgatggcagtcactgggaccaatggtaaatcgtctatttgt
ttttatgcggcacaacttgccgagatgatggggtataagagcggcctggtgggtaccttt
gggatagggccactggagcagttgcaaacggcggatcagacgaccccagatattttgacc
atgcatcaaaccttgatgtccttaactcagcagggtattgactatgtggctttcgaggct
tcttctcatgctttggatcaagggcgaattcatggggtgccttttcagacggcggttttc
tctaatttgacccgtgatcatttggattatcatggggacatggcgtcttacgcggctgcg
aagcaaaagttgtttgcctttcccagtgtgcaagaggccgtgtattgcttggatgatgag
tatgttggttttatgactcaacctgcgataaatgcccattgtatctattacagtgaagcc
aattcacaagccgatttttataccaagcaattgacgttggagcccactggatgccgtttt
gtcttgtgtcatccagaaggtgagacggatgtatttttacctttgctaggtcgttttaat
gtacaaaatgctttagcggctttggcttgtttgtggtcagcagcaaagaataaggccgcg
ctcatagcctgtttgtctgagttgaaaggtgctccaggtcgaatggataaagtcgaggta
ttagccgcgccccttgttgtggtggattttgcccatacctcagacgcattagagagtgct
ttaaacgcgattagagagcatattaatgggcgcttaatttgtgtctttggttgtggtggt
gatcgagatcgaggtaagcgacctctaatgatgtcagcggcattggataatgcggattca
gtatggcttacatcagacaatccaagaaccgaatcagttgagcaaatcttttcagatgtg
ttggcgaaaactgacagtcaagcctgttaccatctgcaggccgatcgacgcttggcgata
catgaggcgatcatgtctgcgaaccctgacgatgttattttagtggcgggtaaaggtcat
gaagcctatcaggatattgatggtgttaagtatcattttgatgataaagaagaagcttat
aaggtgttagagcattatgttagttag

DBGET integrated database retrieval system