KEGG   Marinomonas posidonica: Mar181_1522Help
Entry
Mar181_1522       CDS       T01508                                 

Definition
Recombination protein recR
Orthology
K06187  
recombination protein RecR
Organism
mpc  Marinomonas posidonica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mar181_1522
DNA repair and recombination proteins [BR:mpc03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Mar181_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1644257..1644850
Genome map
AA seq 197 aa AA seqDB search
MFSPLISELIESLRCLPGVGPRSAQKMALYLLERDHQGADKLASSLREALDKVGRCGSCR
TLTEESECDICQDPERDKKHLCIVETPADVVAIESAGAYRGRYFVLLGHLSPIDGIGPEE
LGLDRLEALVVENEVEEAIIATNSTVEGEATCHYIAEKLKTLNINVSRIAHGVPMGGELE
YVDGNTLALALEGRKTL
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
ttgtttagtcctcttatttcggaactgattgagtctttgcgttgtttgcctggtgttggg
ccgcgttcagctcagaaaatggctttatacttgttggaacgtgaccatcaaggcgccgac
aaactggccagctcactgcgcgaagctttagacaaagttgggcgttgtggcagctgtcgt
acgttaacggaagagtccgagtgcgatatttgtcaggatccagagcgcgataaaaagcac
ttatgtatcgttgaaacaccagcagatgtcgtggcgattgaatcggctggtgcgtatcga
gggcgttattttgtcttgcttgggcacttatctccgattgatggaattgggccggaagag
ttaggactggatcgtttggaggccttggtggtcgaaaacgaagtagaagaagccataatc
gcaacaaactccacagtagaaggcgaggcgacttgtcattatattgcggaaaaactcaaa
acattgaatattaatgtaagccgcattgcccatggtgtgcccatgggcggtgagttggaa
tacgttgatggcaatactctggccttagcgttagagggacggaagacactctaa

DBGET integrated database retrieval system