KEGG   Marinomonas posidonica: Mar181_1605Help
Entry
Mar181_1605       CDS       T01508                                 

Definition
Tryptophan synthase subunit alpha (EC:4.2.1.20)
Orthology
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mpc  Marinomonas posidonica
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Mar181_1605
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Mar181_1605
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Mar181_1605
Enzymes [BR:mpc01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Mar181_1605
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1726726..1727532
Genome map
AA seq 268 aa AA seqDB search
MSRIKQCFENLEKSGKKALIPYITAGDPSPKHTVTMMNALVDAGADVIEIGMPFSDPMAD
GPVIQLACERSLAAGTSVRKVLEIIAEFRQGNSTTPVVLMGYLNPIEFFGYQEFADAAKE
AGVDGVLLVDLTPEEATDVVECFRQNEIDLIYLLSPTTTLERAKKICALASGYVYYVSVK
GVTGSSELDVDSVKQHVETLRSVTSLPIGVGFGIRDAKTAAAVSRCSDGVIVGSVLVNCI
AENKDQQKEYIADALGAILTPMRSEMDA
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagtcgcataaagcaatgttttgaaaatttagaaaaatctggtaaaaaggcgctcatt
ccatatatcacggcaggtgacccttctccaaagcacacagtgaccatgatgaatgcgcta
gtggatgcgggtgccgatgtaattgagatcggtatgccgttctctgatccaatggcggat
ggtccggttattcagcttgcctgtgaacgcagtttggccgctggcaccagtgtccgaaaa
gtattggaaatcattgctgagtttaggcaaggcaatagcactaccccagtggttttgatg
ggctatttaaacccaattgagttctttggttatcaagaatttgctgatgcagcaaaagaa
gctggggtagatggcgttttattagtagatctgactccagaagaggcgacagatgtagta
gaatgcttccgacaaaatgagattgatctgatttacttgctgtctccgactaccacgctt
gagcgagcaaagaaaatttgtgccctagcgtctggttatgtgtattacgtttcagtaaaa
ggcgtaacaggttcaagtgaattggacgtggacagtgttaagcagcatgtagagacttta
cgcagtgtaacgtcattaccgattggggtaggttttggcatccgtgatgcaaaaacggcc
gccgcggtgagtcgttgctctgatggtgtgattgtcggtagcgtattagtgaattgcatt
gctgaaaataaagatcaacaaaaagaatatatagctgacgctctaggggcaattttgact
ccgatgcgtagtgaaatggacgcctga

DBGET integrated database retrieval system