KEGG   Marinomonas posidonica: Mar181_1716Help
Entry
Mar181_1716       CDS       T01508                                 

Definition
alcohol dehydrogenase GroES domain-containing protein
Orthology
K13953  
alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mpc  Marinomonas posidonica
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Mar181_1716
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mar181_1716
  Lipid metabolism
   00071 Fatty acid degradation
    Mar181_1716
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mar181_1716
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mar181_1716
   00626 Naphthalene degradation
    Mar181_1716
Enzymes [BR:mpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mar181_1716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1864971..1865987)
Genome map
AA seq 338 aa AA seqDB search
MKAAVANQFGNILKIEEVAKPQISSHQVLVKIHACGVCHTDLHACHGDWPVKPSLPLIPG
HEGVGEIVEIGANVQHLNIGDRVGIPWLYSACGHCEYCLSGDENLCLSQQNAGYSVDGGY
AEYCAAHADYVIKVPDGLSYVDAAPLFCAGVTTYKALKVSQAKPGNWVAIFGIGGLGHLA
VQYAAAMGLRVVAVDTGDAKRQLATKLGAEQYFDFKTDNVVDEILNLTGGVHATVCTAVS
KAGFRQSYDVVRRGGKCVLVGLPPEDMPLPIFNTVLNGVSVVGSIVGTRKDLEECLEFAA
RGKVKAIIEEKQLEDINDIFSDMEKGDITGRIVMSLNH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggctgtcgcaaaccaatttggcaacatattgaaaatagaagaggtggccaaa
cctcaaataagttctcatcaagtcttagtcaaaatacatgcttgtggtgtatgtcatacg
gatttacatgcttgtcatggtgattggccggtcaaaccaagcctaccattaatcccagga
catgaaggtgtcggtgaaattgttgaaattggtgccaatgttcagcatctcaatattggt
gacagggtcggcatcccttggttgtacagtgcttgtggacattgtgaatactgtctttca
ggagatgaaaacctttgtttatctcaacaaaatgcagggtattctgttgatggtggttat
gctgaatactgtgctgcgcatgcggattatgtcattaaagtacctgatggtttaagttat
gtggacgctgcccctttgttttgtgctggcgtgaccacttataaagccttaaaagtttcc
caggctaagccaggaaactgggtcgcaatttttggaattggtgggttagggcacttagcg
gttcagtatgcggctgccatgggattacgtgttgttgcagtcgatactggtgacgctaaa
cgtcaattggccacaaaactcggtgctgagcagtattttgactttaaaacagacaatgtc
gtagatgaaatattaaaccttacagggggagttcatgcgacggtatgtactgctgtgagc
aaagctggctttcgacaaagttacgatgtggtccgacgaggaggaaaatgcgtattggta
ggactaccaccagaagacatgcctttacctatttttaataccgttttaaatggtgttagt
gtggtggggtccatcgttggtactcgaaaagacttagaagagtgtcttgaattcgctgca
cgtggcaaagtgaaagccattattgaagagaagcaactcgaagacattaatgacattttt
tccgacatggaaaaaggcgacattacagggcggatcgtgatgtcattaaatcattaa

DBGET integrated database retrieval system