KEGG   Marinomonas posidonica: Mar181_1716Help
Entry
Mar181_1716       CDS       T01508                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
mpc  Marinomonas posidonica
Pathway
mpc00010  Glycolysis / Gluconeogenesis
mpc00071  Fatty acid degradation
mpc00350  Tyrosine metabolism
mpc00625  Chloroalkane and chloroalkene degradation
mpc00626  Naphthalene degradation
mpc01100  Metabolic pathways
mpc01110  Biosynthesis of secondary metabolites
mpc01120  Microbial metabolism in diverse environments
mpc01130  Biosynthesis of antibiotics
mpc01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Mar181_1716
  Lipid metabolism
   00071 Fatty acid degradation
    Mar181_1716
  Amino acid metabolism
   00350 Tyrosine metabolism
    Mar181_1716
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Mar181_1716
   00626 Naphthalene degradation
    Mar181_1716
Enzymes [BR:mpc01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Mar181_1716
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 2-Hacid_dh_C AlaDh_PNT_C adh_short 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: AEF54754
JGI: Mar181_1716
UniProt: F6D014
Position
complement(1864971..1865987)
Genome map
AA seq 338 aa AA seqDB search
MKAAVANQFGNILKIEEVAKPQISSHQVLVKIHACGVCHTDLHACHGDWPVKPSLPLIPG
HEGVGEIVEIGANVQHLNIGDRVGIPWLYSACGHCEYCLSGDENLCLSQQNAGYSVDGGY
AEYCAAHADYVIKVPDGLSYVDAAPLFCAGVTTYKALKVSQAKPGNWVAIFGIGGLGHLA
VQYAAAMGLRVVAVDTGDAKRQLATKLGAEQYFDFKTDNVVDEILNLTGGVHATVCTAVS
KAGFRQSYDVVRRGGKCVLVGLPPEDMPLPIFNTVLNGVSVVGSIVGTRKDLEECLEFAA
RGKVKAIIEEKQLEDINDIFSDMEKGDITGRIVMSLNH
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcggctgtcgcaaaccaatttggcaacatattgaaaatagaagaggtggccaaa
cctcaaataagttctcatcaagtcttagtcaaaatacatgcttgtggtgtatgtcatacg
gatttacatgcttgtcatggtgattggccggtcaaaccaagcctaccattaatcccagga
catgaaggtgtcggtgaaattgttgaaattggtgccaatgttcagcatctcaatattggt
gacagggtcggcatcccttggttgtacagtgcttgtggacattgtgaatactgtctttca
ggagatgaaaacctttgtttatctcaacaaaatgcagggtattctgttgatggtggttat
gctgaatactgtgctgcgcatgcggattatgtcattaaagtacctgatggtttaagttat
gtggacgctgcccctttgttttgtgctggcgtgaccacttataaagccttaaaagtttcc
caggctaagccaggaaactgggtcgcaatttttggaattggtgggttagggcacttagcg
gttcagtatgcggctgccatgggattacgtgttgttgcagtcgatactggtgacgctaaa
cgtcaattggccacaaaactcggtgctgagcagtattttgactttaaaacagacaatgtc
gtagatgaaatattaaaccttacagggggagttcatgcgacggtatgtactgctgtgagc
aaagctggctttcgacaaagttacgatgtggtccgacgaggaggaaaatgcgtattggta
ggactaccaccagaagacatgcctttacctatttttaataccgttttaaatggtgttagt
gtggtggggtccatcgttggtactcgaaaagacttagaagagtgtcttgaattcgctgca
cgtggcaaagtgaaagccattattgaagagaagcaactcgaagacattaatgacattttt
tccgacatggaaaaaggcgacattacagggcggatcgtgatgtcattaaatcattaa

DBGET integrated database retrieval system