KEGG   Marinomonas posidonica: Mar181_1748Help
Entry
Mar181_1748       CDS       T01508                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mpc  Marinomonas posidonica
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:mpc01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1896443..1897060
Genome map
AA seq 205 aa AA seqDB search
MFVKITQKIVLIFGFLCLTTSSFAANLLVMGDSLSAAYNLRQQDGWVSLLKNQLNQSHPS
IEVINASVSGETTQGGLSRFPALLTQYRPKWVILELGANDALRGYPLNQTSDNLKNMVEL
SLQVGAEVLLIGNQIPQNYGKRYTKMFFELYKGIADQYQIAYLPFMLQNVALDKDLMQND
GLHPNKAGQPIVLENILPYLQPLLD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtaaaaataactcaaaaaatcgttttaatatttggctttctgtgtctaacaaca
agttcatttgctgccaatttactggtaatgggtgacagtcttagtgctgcctataaccta
agacaacaagatggttgggtaagtttactaaaaaatcaattaaatcaatcacaccctagt
atcgaggtaatcaacgccagtgtcagtggtgaaacaactcaagggggcttgtctcgtttt
cctgcgctactgacacaatatcgacctaaatgggtgatattagaactgggggccaacgac
gctttacgtggttaccctttaaatcagacctctgataatttaaaaaatatggtcgaacta
tctttgcaagttggtgctgaggtgttgctaattggcaaccaaatccctcaaaactatggt
aaacgttacactaaaatgttttttgagttatataaaggcattgccgatcaatatcaaatt
gcgtatttacctttcatgctgcaaaacgtcgcactcgataaagacctcatgcaaaatgac
ggactacaccctaataaagcaggccaacctattgtgctagaaaatatcctgccatattta
cagccattattagactaa

DBGET integrated database retrieval system