KEGG   Marinomonas posidonica: Mar181_1748Help
Entry
Mar181_1748       CDS       T01508                                 

Definition
arylesterase (EC:3.1.1.2)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
mpc  Marinomonas posidonica
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Mar181_1748
Enzymes [BR:mpc01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Mar181_1748
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Mar181_1748
Lipid biosynthesis proteins [BR:mpc01004]
 Fatty acid synthase
  Component type
   Mar181_1748
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1896443..1897060
Genome map
AA seq 205 aa AA seqDB search
MFVKITQKIVLIFGFLCLTTSSFAANLLVMGDSLSAAYNLRQQDGWVSLLKNQLNQSHPS
IEVINASVSGETTQGGLSRFPALLTQYRPKWVILELGANDALRGYPLNQTSDNLKNMVEL
SLQVGAEVLLIGNQIPQNYGKRYTKMFFELYKGIADQYQIAYLPFMLQNVALDKDLMQND
GLHPNKAGQPIVLENILPYLQPLLD
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atgtttgtaaaaataactcaaaaaatcgttttaatatttggctttctgtgtctaacaaca
agttcatttgctgccaatttactggtaatgggtgacagtcttagtgctgcctataaccta
agacaacaagatggttgggtaagtttactaaaaaatcaattaaatcaatcacaccctagt
atcgaggtaatcaacgccagtgtcagtggtgaaacaactcaagggggcttgtctcgtttt
cctgcgctactgacacaatatcgacctaaatgggtgatattagaactgggggccaacgac
gctttacgtggttaccctttaaatcagacctctgataatttaaaaaatatggtcgaacta
tctttgcaagttggtgctgaggtgttgctaattggcaaccaaatccctcaaaactatggt
aaacgttacactaaaatgttttttgagttatataaaggcattgccgatcaatatcaaatt
gcgtatttacctttcatgctgcaaaacgtcgcactcgataaagacctcatgcaaaatgac
ggactacaccctaataaagcaggccaacctattgtgctagaaaatatcctgccatattta
cagccattattagactaa

DBGET integrated database retrieval system