KEGG   Marinomonas posidonica: Mar181_1753Help
Entry
Mar181_1753       CDS       T01508                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mpc  Marinomonas posidonica
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1899906..1900916
Genome map
AA seq 336 aa AA seqDB search
MFQHSMKQANQLMRSAIPLMVKLDIPPTPYNYGIWYEYASNNNPKLNQVVDRTIRRFGTL
PAFVSKELFNEFIIADDIKPADAQRKSLDELTEKLNDESASVTKELSTFTQSLSHTRAAL
KVNTDKEKLIHIANLLDRRTFKANQVVEQFGETLSEVQNELTRLRRELAEVKKSTELDQM
TLLANEKGFERTLFAWAPFAEDDLTLLIIDIDNLSQINQDYSKKVGSSLILYIAKTLSSV
LPDKAYIARLKGGQFVVLVKDMELGEASKLADSIRLNISNQKIRNKDNNTLLKQITVSIG
VATLLGDEGPSELVQRAQHYLTYAKRSGKNCIAHHV
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgttccagcatagtatgaaacaggccaaccagcttatgcgttcggccattccattaatg
gtcaaattggacatcccaccaacaccatacaattatggtatttggtatgaatatgcatca
aataacaacccaaaattaaatcaagtcgttgatcgtactattcgtcgcttcggtacctta
ccggcttttgtttcaaaagaactgttcaatgaatttattattgccgatgatattaaacct
gcagacgcacaacgcaaaagcctagatgagctcaccgagaagctcaatgacgagagcgcc
tctgttaccaaagaactctctaccttcacccaatctctcagtcacactcgtgccgcttta
aaagtaaatactgacaaagaaaaactcattcatatcgcgaatttacttgaccggcgtact
tttaaagccaatcaagtggtagagcaatttggcgaaaccttatcagaggtacaaaacgaa
ttgacacgtcttagacgtgaattagctgaggttaagaaaagcacagaacttgatcaaatg
acgttattggctaatgaaaaaggctttgaacgcaccttgtttgcttgggcgccatttgca
gaagatgaccttactttattgataattgacatagataatctgagtcaaataaatcaagac
tacagcaagaaagtgggctcttcacttattttgtatattgcgaagaccttatcaagtgtt
ttaccagataaggcctatattgctcgccttaaaggtggtcagtttgttgtcttagtcaag
gatatggagcttggagaggcttctaaattggctgactccatccgattgaatatctcaaat
caaaaaattcgtaataaggacaacaatactttgttgaagcaaattactgtgtcgattggt
gtggccactttgttaggcgatgaaggtccctctgaattagtccagcgtgctcagcactat
ttaacttatgcgaaacgatctggcaaaaactgtattgcccatcatgtataa

DBGET integrated database retrieval system