KEGG   Marinomonas posidonica: Mar181_1767Help
Entry
Mar181_1767       CDS       T01508                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mpc  Marinomonas posidonica
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Mar181_1767
Enzymes [BR:mpc01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Mar181_1767
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1913021..1913623)
Genome map
AA seq 200 aa AA seqDB search
MIGRITGTLAEKSPPELLIDVQGLGYEISASMTTIYDLPQVGERVTLFTHLIVKEDSHTL
FGFSDKSERALFRVLIKVNGIGPKMALAILSSMSAEELIANVQDSDVTALTRIPGVGKKT
AERLIIELRDKLGQAAKGDLFATPAVLKQVQADPRQEAEAALIALGYKPQEAAKAIAAVP
MDSADSESVIKAALQGMLRK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgatagggcgaattaccggaactttggcggaaaaatcgccgccagaattattgattgat
gtacagggtcttggttacgaaattagcgcgtctatgacgaccatttatgatttgccgcaa
gttggtgagcgggtcactttatttacccaccttattgttaaggaagattctcatactctc
tttgggtttagcgataaaagtgaaagggcgctgtttagggtcttaattaaagtcaatggc
attggccctaaaatggcgctcgccatattatcgagtatgtctgcggaagagcttattgct
aatgtacaggattcggatgtcaccgcattaacgcgcattccaggtgttggtaaaaaaacc
gccgagagattaattattgaattacgtgataagcttggtcaggctgcaaaaggggatttg
tttgccacgcctgcggtattgaagcaagttcaagctgacccaaggcaggaagctgaggca
gcgttgatagcattaggctacaagccccaagaagcggccaaagccattgccgcagtgcca
atggatagtgcagacagtgagtctgttattaaagccgcactacaaggaatgttgaggaag
taa

DBGET integrated database retrieval system