KEGG   Marinomonas posidonica: Mar181_1767Help
Entry
Mar181_1767       CDS       T01508                                 

Definition
Holliday junction ATP-dependent DNA helicase ruvA
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
mpc  Marinomonas posidonica
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:mpc03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1913021..1913623)
Genome map
AA seq 200 aa AA seqDB search
MIGRITGTLAEKSPPELLIDVQGLGYEISASMTTIYDLPQVGERVTLFTHLIVKEDSHTL
FGFSDKSERALFRVLIKVNGIGPKMALAILSSMSAEELIANVQDSDVTALTRIPGVGKKT
AERLIIELRDKLGQAAKGDLFATPAVLKQVQADPRQEAEAALIALGYKPQEAAKAIAAVP
MDSADSESVIKAALQGMLRK
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
gtgatagggcgaattaccggaactttggcggaaaaatcgccgccagaattattgattgat
gtacagggtcttggttacgaaattagcgcgtctatgacgaccatttatgatttgccgcaa
gttggtgagcgggtcactttatttacccaccttattgttaaggaagattctcatactctc
tttgggtttagcgataaaagtgaaagggcgctgtttagggtcttaattaaagtcaatggc
attggccctaaaatggcgctcgccatattatcgagtatgtctgcggaagagcttattgct
aatgtacaggattcggatgtcaccgcattaacgcgcattccaggtgttggtaaaaaaacc
gccgagagattaattattgaattacgtgataagcttggtcaggctgcaaaaggggatttg
tttgccacgcctgcggtattgaagcaagttcaagctgacccaaggcaggaagctgaggca
gcgttgatagcattaggctacaagccccaagaagcggccaaagccattgccgcagtgcca
atggatagtgcagacagtgagtctgttattaaagccgcactacaaggaatgttgaggaag
taa

DBGET integrated database retrieval system