KEGG   Marinomonas posidonica: Mar181_1841Help
Entry
Mar181_1841       CDS       T01508                                 

Definition
xylose isomerase domain-containing protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mpc  Marinomonas posidonica
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:mpc00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:mpc00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2008764..2009747)
Genome map
AA seq 327 aa AA seqDB search
MSSNLKFGAGIWHFATYVDRYATDGYGPKRSLLEMIDLAGQVDDLSVVDINYPFPGGNVS
VAEVKAALTKNNLSVIGITPEIYTRQFSKGAFTNPDPAVRKLAEDLINEAADMVRELGAE
YVKLWPGQDGWDYPFQVDHHELWHLSMAGLTNVAKQNPDLKFVVEYKPREPRNHMSYDSM
TRTLLALEKINLPNIGVLLDFGHALYGGESPADSAQLAIDYGRLFGMDVNDNLRSWDDDM
IAGSVHPIELMEFFYVLRKNNWHGVWQLDQFPFREDCVAAANSAISFLKHIDSALDRMDW
DGLKEAQKQQDAVAAINIAREALFGLL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtaatctaaaattcggtgctgggatttggcactttgcaacctacgtagatcga
tacgcgacggatggttatggtcctaaacgatctttattggaaatgattgatttggccggt
caagtggacgatctttctgtggtcgacattaattaccctttccccggggggaatgtgtcc
gtcgcagaagtgaaagcggctctgacgaaaaataatctaagtgtcatcggtatcacacct
gaaatctatactcgtcaattctccaaaggtgcttttacgaatcctgatcctgctgttcgt
aaactggctgaagatttgatcaatgaagcagccgacatggtaagagagctgggggctgag
tatgtgaaactttggcctggtcaagatggttgggactatccatttcaagttgaccatcac
gaactctggcatctctctatggcgggtttgacaaatgttgcgaagcaaaatccagactta
aagtttgtcgttgaatataaaccacgagaaccaagaaaccatatgagttatgacagtatg
actcgcactctgttggcgttggagaaaattaacttacccaacattggagtgttactggat
ttcggacatgcactttatggcggagaatctccggctgactcagcacaactggcaattgat
tatggccgattattcggtatggatgtgaatgataatctgagaagctgggatgacgatatg
attgcaggctcagttcatcctattgagttgatggaatttttttacgtactaagaaaaaat
aattggcacggtgtatggcagcttgatcaatttcctttcagagaggattgtgttgccgca
gccaatagtgccatttcttttctaaaacatattgatagcgctttggatagaatggactgg
gatgggttgaaagaagcacagaaacaacaggatgcggttgcagcgatcaacatcgcaaga
gaggctctgtttggactgctgtaa

DBGET integrated database retrieval system