KEGG   Marinomonas posidonica: Mar181_1841Help
Entry
Mar181_1841       CDS       T01508                                 

Definition
xylose isomerase domain-containing protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
mpc  Marinomonas posidonica
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Mar181_1841
   00051 Fructose and mannose metabolism
    Mar181_1841
Enzymes [BR:mpc01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.5  xylose isomerase
     Mar181_1841
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2008764..2009747)
Genome map
AA seq 327 aa AA seqDB search
MSSNLKFGAGIWHFATYVDRYATDGYGPKRSLLEMIDLAGQVDDLSVVDINYPFPGGNVS
VAEVKAALTKNNLSVIGITPEIYTRQFSKGAFTNPDPAVRKLAEDLINEAADMVRELGAE
YVKLWPGQDGWDYPFQVDHHELWHLSMAGLTNVAKQNPDLKFVVEYKPREPRNHMSYDSM
TRTLLALEKINLPNIGVLLDFGHALYGGESPADSAQLAIDYGRLFGMDVNDNLRSWDDDM
IAGSVHPIELMEFFYVLRKNNWHGVWQLDQFPFREDCVAAANSAISFLKHIDSALDRMDW
DGLKEAQKQQDAVAAINIAREALFGLL
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgtctagtaatctaaaattcggtgctgggatttggcactttgcaacctacgtagatcga
tacgcgacggatggttatggtcctaaacgatctttattggaaatgattgatttggccggt
caagtggacgatctttctgtggtcgacattaattaccctttccccggggggaatgtgtcc
gtcgcagaagtgaaagcggctctgacgaaaaataatctaagtgtcatcggtatcacacct
gaaatctatactcgtcaattctccaaaggtgcttttacgaatcctgatcctgctgttcgt
aaactggctgaagatttgatcaatgaagcagccgacatggtaagagagctgggggctgag
tatgtgaaactttggcctggtcaagatggttgggactatccatttcaagttgaccatcac
gaactctggcatctctctatggcgggtttgacaaatgttgcgaagcaaaatccagactta
aagtttgtcgttgaatataaaccacgagaaccaagaaaccatatgagttatgacagtatg
actcgcactctgttggcgttggagaaaattaacttacccaacattggagtgttactggat
ttcggacatgcactttatggcggagaatctccggctgactcagcacaactggcaattgat
tatggccgattattcggtatggatgtgaatgataatctgagaagctgggatgacgatatg
attgcaggctcagttcatcctattgagttgatggaatttttttacgtactaagaaaaaat
aattggcacggtgtatggcagcttgatcaatttcctttcagagaggattgtgttgccgca
gccaatagtgccatttcttttctaaaacatattgatagcgctttggatagaatggactgg
gatgggttgaaagaagcacagaaacaacaggatgcggttgcagcgatcaacatcgcaaga
gaggctctgtttggactgctgtaa

DBGET integrated database retrieval system