KEGG   Marinomonas posidonica: Mar181_1923Help
Entry
Mar181_1923       CDS       T01508                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
mpc  Marinomonas posidonica
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:mpc00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Mar181_1923
Enzymes [BR:mpc01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Mar181_1923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2093225..2095195)
Genome map
AA seq 656 aa AA seqDB search
MKLGVCYYPEHWPTSRWRTDAEQMKKIGIEYVRVGEFSWSTIEPTPEQMNWQWLDESLDI
LHEYGLKVILGTPTATPPKWLVDRNPGMLAKDEQGRERGFGSRRHYTFASLEYREECRRI
VTIMAQRYGQHPAVVSWQTDNEFGCHDTILSYADADLTAFRLWLKDKYGTIEALNQAWGN
VFWSMEYRSFDEIELPNLTVTEANPSHRLDFQRCSSDQVVAYNKLQVDILREHSAGRDLV
HNYMGFFTAFDHHKVGEDLDVASWDTYPLGFLDQEAIYTQAEKQTYLRVGHPDFGAFHHD
LYRGCGKGRLWIMEQQPGPVNWAPHNPTPADGAVRLWTWEAFSHGAEMVSYFRWRQAPFA
QEQMHAGLLRPDAEEAEAAKEASKVASEVEQLSQALGMDADELVSLPSAGKVALMFDYDA
CWSLDIQPQSRAYRYLFWCYRSYQALRELGLSVDIIPATASLDTYDMLVLPAQAHISADL
NRRLDAYQGVLLAGPRTGSKTETYQIPENLAPGPLAERLPLQVERVDALPEHTQPAVSGR
WGVGVLKHWHEQIKTDLPCLLKDHGGNPVLVGEGRHYYLGSCLDNSVLKASFAQLAGLAG
LETYYLPEGLRIRERGELIFVMNYASHSIDFVPDGAELVIGSRRLEAANIAIWKKC
NT seq 1971 nt NT seq  +upstreamnt  +downstreamnt
atgaaattaggtgtttgttattacccagagcattggccaacttcgcgctggcgcactgat
gcggaacagatgaagaaaatcggcattgaatatgttcgtgtcggtgaattcagttggagc
actattgagcccacgccggaacagatgaattggcaatggctagatgagtcattggatatc
ttgcatgaatacggcttgaaggtcattttaggtacacccaccgctacgccgcctaagtgg
ttggtcgatcgtaaccctggcatgttggctaaagatgaacaggggcgtgagcgtggtttt
ggttcgcgccgccattacacctttgccagtctagaataccgtgaagagtgtcgtcgaatt
gtgaccataatggcacagcgatatggtcagcatccggcggttgtgtcttggcaaacggat
aacgaatttggttgtcacgatacaattctcagttatgctgacgcggatttgacggccttt
cggctttggctaaaagacaaatacggcaccattgaggccttgaatcaggcttggggtaat
gttttctggagcatggaataccgcagttttgacgaaatagagctgccaaatcttacggtg
actgaagccaatccttctcatcgtttggattttcagcgctgcagctcagatcaggttgtt
gcctacaataagttgcaggtagacattctgcgcgagcattcagcagggcgtgatctggtt
cataactacatgggattttttaccgcttttgatcatcataaagtaggtgaagaccttgat
gtggcaagttgggacacgtatccgcttggtttcttagatcaagaagcaatttatacacaa
gccgaaaagcaaacctatttacgagtggggcatccagactttggcgctttccaccatgat
ttgtatcgtggttgtggcaaagggcgcttgtggatcatggaacaacagcctggtccggta
aactgggcgccacacaatccaacgcctgctgatggcgctgtgcgtttgtggacatgggaa
gccttttctcatggggcagaaatggtgtcctattttcgttggcgacaagccccatttgct
caagaacaaatgcatgcaggcttgttacgacctgatgcggaagaagctgaggctgctaaa
gaggcgtcaaaagtcgcgtcagaagttgaacagctatcgcaagctctggggatggatgca
gatgaacttgtgtcgttaccgagtgccggtaaagtggcattgatgtttgattatgatgct
tgttggtcattggatattcagcctcaatctagagcttatcgatatctattctggtgttat
cgaagttatcaagcgcttcgtgaattgggattgtcggtcgatattattcccgctaccgcc
tcattagacacttatgacatgttggtgttgcccgcccaagctcacatctctgctgattta
aatcgtagattagatgcttatcaaggggttctattagcaggacctagaacgggcagtaag
accgaaacttaccaaattcctgaaaatttagcgcccggcccactagcggaacgattgcct
ctgcaagttgaacgtgtggatgcgcttcctgagcatactcagcctgcagtatcaggacgt
tggggggtaggggtgctgaagcactggcatgagcaaatcaaaacggatttaccttgcctg
ttaaaagaccatggcggtaaccctgtcttagtcggcgaaggtcgccattattatttaggg
tcttgtctggataattcggtactcaaagcgagctttgctcagctggctgggttggcgggc
ttagagacttattacctgcctgaaggtctcagaatccgtgaaagaggggagttgatcttt
gtgatgaattacgcctctcatagcattgactttgtgccagacggtgcggagttagtcatc
ggaagtcgtcgcttggaagcggcaaatattgctatttggaaaaagtgctaa

DBGET integrated database retrieval system